KEGG   Rattus norvegicus (rat): 294972
Entry
294972            CDS       T01003                                 
Symbol
Mccc1
Name
(RefSeq) methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial
  KO
K01968  3-methylcrotonyl-CoA carboxylase alpha subunit [EC:6.4.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00280  Valine, leucine and isoleucine degradation
rno01100  Metabolic pathways
Module
rno_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    294972 (Mccc1)
Enzymes [BR:rno01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     294972 (Mccc1)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATP-grasp Biotin_lipoyl_2 ATP-grasp_3 RimK ATPgrasp_ST ATP-grasp_4 GARS_A Ntox43 HlyD_D23 ATPgrasp_Ter RnfC_N DUF2118 NQRA
Other DBs
NCBI-GeneID: 294972
NCBI-ProteinID: NP_001009653
RGD: 1310615
Ensembl: ENSRNOG00000013293
UniProt: Q5I0C3
Position
2:complement(118799147..118851181)
AA seq 715 aa
MAAAALLAAVDRNQLRRVPILLLQPREWPWKHRTVKYGTTPGGSITKVLIANRGEIACRV
IRTARKMGVQSVAVYSEADRNSMHVDMADEAYSIGPAPSQQSYLAMEKIIQVAKSSAAQA
IHPGYGFLSENMEFAEFCKQEGIIFIGPPSTAIRDMGIKSTSKSIMAAAGVPVVEGYHGN
DQSDECLKEHAGKIGYPVMIKAIRGGGGKGMRIIRSEKEFQEQLESARREAKKSFNDDAM
LIEKFVDTPRHVEVQVFGDHHGNAVYLFERDCSVQRRHQKIIEEAPAPGIDPEVRRRLGE
AAVRAAKAVNYVGAGTVEFIMDSKHNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRIAA
GEKIPLSQEEIPLQGHAFEARIYAEDPDNNFMPGAGPLVHLSTPPPDMSTRIETGVRQGD
EVSVHYDPMIAKLVVWASDRQSALSKLRYSLHQYNIVGLRTNVDFLLRLSGHSEFEAGNV
HTDFIPQHHKDLLPTHSTIAKESVCQAALGLILKEKEMTSAFKLHTQDQFSPFSFSSGRR
LNISYTRNMTLRSGKNDIIIAVTYNRDGSYDMQIENKLFRVLGDLSNEDGYTYLKSSVNG
VASKSKFILLDNTIYLFSMEGSIEVGIPVPKYLSPVSAEGTQGGTIAPMTGTIEKVFVKA
GDRVKAGDALMVMIAMKMEHTIKAPKDGRIKKVFFSEGAQANRHAPLVEFEEEEV
NT seq 2148 nt   +upstreamnt  +downstreamnt
atggcggcggcggctctgttggctgcggtggacaggaaccagttgcggcgggtcccgatc
ctgctgctgcagccgagggaatggccttggaagcacagaaccgtgaaatatggaacaacc
ccaggaggaagcatcaccaaggtcctcattgcaaacagaggagaaattgcctgcagggtg
atacgaacagccagaaaaatgggtgtacaatctgtggctgtttacagcgaggccgacagg
aattccatgcatgtagatatggcagacgaggcgtattccattggccctgcgccatctcag
cagagctacctcgcaatggagaaaatcatccaagtggccaagagctctgcagcacaggcc
atccatccaggatatggttttctttcagaaaatatggagtttgctgaattttgtaagcaa
gaaggaattatttttataggtcctccttcaactgcaattagagacatgggtataaagagc
acatccaagtccatcatggctgccgctggagtacctgttgtggaaggttaccatggcaac
gaccaatctgatgagtgcctgaaagagcatgcagggaaaatcgggtatcctgtgatgatc
aaagccatccgtggtggaggaggaaaaggcatgaggatcattaggtcagaaaaagaattc
caagagcagctagaatcagcccggagggaggcaaagaagtctttcaacgatgacgcaatg
ctgatcgagaagttcgtggacacgccaaggcatgtggaagtccaggtgtttggtgatcac
catggcaatgcagtgtacttgtttgaaagagactgtagtgtgcagaggcgacatcagaag
atcattgaggaggccccagcgcctggtattgatcctgaagtaagaaggaggctgggagag
gctgcagtcagagctgcgaaggctgtcaactatgtgggagcaggaactgtggaattcatt
atggactcaaagcacaatttttatttcatggagatgaacacaaggctacaagtggagcat
ccggtcactgagatgatcacggggactgacttggtggagtggcagctcaggattgcagca
ggggaaaagatccctttgagccaggaagaaatccctctgcagggccatgcctttgaggcc
agaatctatgcagaggatcctgacaataacttcatgccaggagctggaccattagttcac
ctctctacccctccgccagacatgtctacaaggatcgaaactggagtacggcaaggagat
gaagtctcggtgcattacgaccccatgatcgcaaagctggtggtgtgggcctcagatcgc
cagtcagccctgtcaaaactgagatacagtcttcatcagtacaacattgttggcttgcgc
accaatgtggacttcctgctccggctctccggccactcagagtttgaagctgggaatgta
cacactgacttcatccctcaacaccacaaggacctgctgcccactcacagcaccatagcc
aaggaatctgtgtgccaggcagccttggggcttatcctcaaagagaaagaaatgaccagc
gcttttaaactccacactcaagatcaattctctccgttttcattcagcagtgggagaaga
ctgaatatctcttacaccaggaacatgactttaagaagtggtaaaaacgatataatcata
gctgtgacgtataaccgagatgggtcatatgacatgcagattgaaaataagttattccga
gtcctgggcgatctttccaatgaggatggctatacctacctgaagtcttctgttaatgga
gtagccagtaaatccaagttcatcctcctggacaacaccatctacctgttttctatggaa
ggcagtattgaagttggcattccagtacccaagtacttgtctccagtgagtgcagaagga
actcagggaggcaccatcgctcccatgactggaaccattgaaaaggtgttcgtgaaggct
ggagacagagtaaaggctggagacgctctgatggttatgatcgccatgaagatggagcac
accataaaagccccaaaggacggcaggataaaaaaggtgtttttcagtgaaggagcccaa
gccaacagacatgcacctttagtggagtttgaagaggaggaagtctga

DBGET integrated database retrieval system