KEGG   Rattus norvegicus (rat): 294973
Entry
294973            CDS       T01003                                 

Gene name
Acad9
Definition
(RefSeq) complex I assembly factor ACAD9, mitochondrial
  KO
K15980  acyl-CoA dehydrogenase family member 9 [EC:1.3.99.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    294973 (Acad9)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     294973 (Acad9)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    294973 (Acad9)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 Phage_TTP_11
Other DBs
NCBI-GeneID: 294973
NCBI-ProteinID: NP_861433
RGD: 727973
Ensembl: ENSRNOG00000014178
UniProt: B1WC61
Position
2
AA seq 625 aa
MSGYVLFSRGATAAAAAARASRVLRVFTERRRTLHTSLQSCSFAKELFLGHIQQKGVFPF
PEVSQEELSEINQFVGPLEKFFNEEVDSRKIDQEGKIPADTLAKLKSLGLFGIQVPEEYG
GLGLSNTMYARLGEIISMDASITVTLAAHQAIGLKGIILVGNEEQKAKYLPKLSSGEHIA
AFCLTEPASGSDAASIQTRATLSEDKKYFVLNGSKVWITNGGLANIFTVFAKTEVVDSDG
SIKDKMTAFIVERDFGGITNGKPEDKLGIRGSNTCEVHFENTRVPVENVLGEVGGGFKVA
MNILNSGRFSMGSAVAGMLKKLIEQTAEYACTRKQFNRNLSEFGLIQEKFALMAQKAYVM
ESMAYLTSGMLDQPGFPDCSIEAAMVKVFSSEAAWQCVSEALQILGGSGYMKDYPYERML
RDARILLIFEGTNEILRLFIALTGLQHAGRILTSRIKELKSGNVTTVMETIGRKLRDSLG
RTVDLGLSSNIAVVHPSLGDSANKLEENVHYFGRTVETLLLRFGKTIVEEQLVLKRVANI
LINLYGMTAVLSRASRSIRIGLKNHDHEILLANMFCVEAYFQNLFSLSQLDKYAPENLDE
QIKKVSQQILEKRAYICAHPLDRAS
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgtctggctatgtactgttctcgcgtggggcgactgcggcggcagctgcggcgcgagct
tcccgcgtgctgagggtcttcacggagaggcgccgcacattgcacaccagtctgcagagc
tgctcgttcgccaaggagctcttcctgggtcacatccagcagaaaggagttttcccattt
ccagaggttagtcaagaagagcttagtgaaatcaatcagtttgtgggaccgttggaaaaa
ttctttaatgaagaagtggactctcgaaaaattgaccaggagggaaaaatcccagctgac
accttagcgaagttgaagagcctgggactttttggcattcaggtcccagaagaatatggt
ggcctgggcctctccaacaccatgtatgcccggcttggggagatcatcagcatggatgcg
tccatcacagtgaccctggcagcacaccaagctatcggcctcaaggggattatcctggtc
ggcaatgaggagcagaaggccaagtatctgcccaaactgtcgtctggggaacacatcgca
gccttctgcctaacggagccagccagtgggagtgatgctgcctccatccagaccagagct
acgttaagtgaagataagaagtactttgttctcaatggctccaaggtttggatcactaat
ggaggactggccaatatttttactgtgtttgcaaaaactgaggtggttgattctgatggt
tcgataaaagacaaaatgaccgcattcatagtagaacgagactttggtggaatcactaat
gggaaacctgaagataaattaggcattcgaggctccaacacatgtgaagtccattttgaa
aataccagagtgccggtggagaatgtccttggagaagttgggggtggctttaaggtggcc
atgaacatcctcaacagtggacgattcagcatgggcagtgctgtggccgggatgctcaag
aaactgattgaacagactgctgagtatgcctgtacgaggaaacagttcaataggaatctc
agtgaatttgggctgattcaggaaaagtttgcgctcatggctcagaaggcgtatgtaatg
gagagtatggcttacctcacttcagggatgctggaccaaccgggatttcccgactgctct
atcgaggcagccatggtgaaggtgtttagctctgaggctgcctggcagtgtgtgagcgag
gctctgcagatccttgggggctcaggctacatgaaggactacccttatgagcgcatgcta
cgtgatgcccgcattctcctaatttttgagggaaccaatgagattcttcggttgttcatt
gccctgacaggcctgcagcatgctggacgcatcctgacctcgaggatcaaagagctcaaa
agtggcaatgtgaccacagtcatggagacgattggtcggaagcttcgggactcgctgggc
cgaactgtagacctggggctgtcgagcaatattgctgttgtccaccccagtcttggagac
agtgccaacaagctggaagaaaatgtgcattactttggccggactgttgagaccctgtta
ctccgatttggaaagaccattgtagaggaacagctggtgttgaagcgggtagccaacatc
ctcatcaacctgtatggcatgaccgctgtgctgtcaagggccagccgctccatcagaatt
gggctcaagaatcacgaccatgagattctgttggccaacatgttctgcgtggaagcttat
ttccagaatctcttcagcctgtctcagctggacaagtatgctccagagaacctggatgaa
cagattaagaaggtgtctcagcagatccttgagaagcgagcctacatctgtgcccaccct
ctggacagagcatcctga

DBGET integrated database retrieval system