KEGG   Rattus norvegicus (rat): 294978
Entry
294978            CDS       T01003                                 

Gene name
RGD1307100, RGD1309985, RGD1561393
Definition
(RefSeq) similar to RIKEN cDNA D630029K19
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: FSA_C
Other DBs
NCBI-GeneID: 294978
NCBI-ProteinID: NP_001032261
RGD: 1307100
Ensembl: ENSRNOG00000038436
Vega: OTTRNOG00000001102
UniProt: Q498R5
Position
2q25
AA seq 191 aa
MQLEFKSIHVQEPQEPSLQDANVKPKVECSVVTEFTDHICVTMDAELIMFLHDLVSAYLK
EKEKAIFPPRILSTRPGQKCPVIIQDDNSSDRDREDGITYTTVDWRDFMCNTWHLEPTLR
LISWTGRKIDPVGVDYILQKLGFHHARTTIPKWLQRGVMDPLDKVLSVLIKKLGTALQDE
KEKKGKDKEEH
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagctagaatttaaatcaattcatgttcaagaaccccaggagccttcattacaagat
gccaacgtgaaacccaaggtggagtgcagtgtggtgacagagttcacggaccacatctgt
gtgacgatggatgctgagctcatcatgtttctccatgatctagtgtcagcatatctgaaa
gaaaaggaaaaggccatttttccacctcggattttatccactcgaccaggacaaaagtgt
ccagttattatacaggatgacaattcctctgacagagacagagaagacggcatcacttac
accactgtggactggcgagactttatgtgtaacacatggcatctggagcctactcttaga
ttaatttcttggactggaagaaagattgatccagtaggtgttgattacattcttcaaaaa
ttgggctttcaccatgccaggactactattcccaaatggcttcagagaggagtgatggac
ccactggataaggtgctatccgttctcatcaaaaaactcgggactgccctgcaggatgag
aaggagaagaaaggaaaagacaaagaagaacactag

DBGET integrated database retrieval system