KEGG   Rattus norvegicus (rat): 29500Help
Entry
29500             CDS       T01003                                 

Gene name
Slc10a2, ASBT, IBAT, ISBAT, ISBT
Definition
(RefSeq) solute carrier family 10 member 2
  KO
K14342  solute carrier family 10 (sodium/bile acid cotransporter), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    29500 (Slc10a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29500 (Slc10a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC10: Sodium bile salt cotransporter
   29500 (Slc10a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SBF Corona_RPol_N
Motif
Other DBs
NCBI-GeneID: 29500
NCBI-ProteinID: NP_058918
RGD: 3682
Ensembl: ENSRNOG00000037753
UniProt: Q62633
Position
16q12.5
AA seq 348 aa AA seqDB search
MDNSSVCSPNATFCEGDSCLVTESNFNAILSTVMSTVLTILLAMVMFSMGCNVEINKFLG
HIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWID
GDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGISLVALVIPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIEPKLWIIGTIFPIAGYSL
GFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVF
AAIILGMYVTYKKCHGKNDAEFLEKTDNDMDPMPSFQETNKGFQPDEK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggataactcctccgtctgttccccaaatgcaactttctgcgaaggtgattcctgccta
gtaactgaaagcaacttcaatgccattctcagcacagtgatgagcaccgtgctcaccatt
cttctagccatggtgatgttttctatggggtgcaatgtggaaatcaacaagttcctagga
cacataaagcggccatggggcatcttcgtgggcttcctctgtcagtttggaatcatgcct
ctcacaggatttatcctgtctgtggcctctggcatccttcctgtgcaggctgtggtggtg
ctaattatgggttgctgccctggaggaactggctccaatatcctggcctattggatagat
ggtgacatggacctcagtgttagcatgaccacttgctccacactgcttgctcttggaatg
atgcccctttgcctcttcatctataccaagatgtgggttgactcaggaacgattgtgatc
ccctacgatagcattggcatttctctggttgcgcttgttattcctgtttccattggaatg
tttgtaaatcacaaatggccccaaaaagcgaagattatacttaaaattggatccatcgca
ggtgcaattctcattgtgctcatagctgtggttggaggaatactgtaccaaagtgcctgg
atcattgaacccaaactatggattataggaacaatatttcctatagctggctacagcctt
ggtttcttcctggctagactagctggtcaaccctggtacaggtgccgaacagttgccttg
gaaactggaatgcagaacactcaactgtgttccaccattgtacaactctcctttagccct
gaggatctcaaccttgtgttcaccttcccactcatctatactgttttccagctcgtcttt
gcagcaataatattaggaatgtatgtcacatacaagaaatgtcatggaaaaaatgatgct
gagtttctagagaaaacagacaatgatatggaccccatgccatcattccaggagacaaac
aagggatttcaaccagatgagaaatag

DBGET integrated database retrieval system