KEGG   Rattus norvegicus (rat): 29501Help
Entry
29501             CDS       T01003                                 

Gene name
Slc12a4, Kcc1
Definition
(RefSeq) solute carrier family 12 member 4
  KO
K14427  solute carrier family 12 (potassium/chloride transporter), member 4/5/6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29501 (Slc12a4)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   29501 (Slc12a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease SLC12
Motif
Other DBs
NCBI-GeneID: 29501
NCBI-ProteinID: NP_062102
RGD: 3687
Ensembl: ENSRNOG00000019651
UniProt: Q63632
Position
19q12
AA seq 1085 aa AA seqDB search
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAEREDSDGQGNHRENSPFLSPLDASRGND
YYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGT
LMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVV
PAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFYPSGT
HDMSSATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLFLACVIISILSIYVGGIKSAF
DPPVFPVCMLGNRTLSRDQFDICAKTVVVDNETVATRLWTFFCHSPNLTADSCDPYFLLN
NVTEIPGIPGAAAGVLQENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSF
TVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGV
VLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIP
FLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQT
LLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMVIAGMIYKYIEYQGAEKE
WGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKA
GKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQS
CGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHER
YLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLY
HLRLEAEVEVVEMHNSDISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRHSAL
RLESLYSDEEDESVTGADKIQMTWTRDKYMAEPWDPSHAPDNFRELVHIKPDQSNVRRMH
TAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREV
ITIYS
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacttcaccgtggtgccggtggacgggccgcgacgcggcgactatgacaacctc
gaggggctcagttgggtggactacggggagcgcgccgagcgggaagactcggatggacag
ggtaaccacagagagaatagtcccttccttagccctttggacgcctccagaggaaatgac
tactatgaccggaacctggcactgtttgaggaggagctggacatccgcccaaaggtatca
tctctcctgggcaagcttgtcagctataccaacctcacccaaggagccaaggagcacgag
gaagctgagagtggagaaggtggccgtcggagagccgccaaggcacccagcatgggcacc
cttatgggagtgtacctgccctgcctgcagaatatcttcggggtcatcctcttcctgcgg
ctgacctggatggtgggcacagctggcgtgctgcaggctctcctcattgtcctcatctgt
tgctgctgtaccctgctgacagccatctccatgagtgccatcgccaccaatggtgtggtt
ccagctggtggctcttacttcatgatttcccgctctttgggaccagaattcggaggtgct
gtgggcctatgcttctacctggggaccacatttgcagcagccatgtatatcctaggagcc
attgagatcttgctgacctacattgctccaccagctgccatcttttacccatcgggcaca
cacgacatgtcaagcgccaccttgaataacatgcgggtgtacggaaccattttcctgact
ttcatgaccctagtggtgtttgtcggtgtcaagtatgtgaacaagttcgcctcactcttc
ctggcctgtgtgatcatctccatcctctccatttacgtgggaggcatcaagtccgctttt
gaccctcctgtttttccggtgtgcatgctgggcaataggactctgtctcgggaccagttt
gacatctgtgccaagacagttgtggtggacaatgagacagtggccacccggctgtggact
ttcttctgccacagccccaaccttactgctgactcctgtgacccctacttcctgctcaac
aatgtgacagagattcctggcatacctggggcagctgctggtgtgctccaggaaaacctg
tggagtgcttacctggagaagggtgaggttgtggagaagcatgggctgccctccacagat
acccttggcctgaaggagagcctgtccctgtatgtggtggccgacatcgccacatccttc
accgtgctggttggcatctttttcccttctgtaacaggcatcatggctggctcaaaccgt
tccggggacctccgtgatgctcagaagtctatccctgtggggaccattctggctattgtc
accacttcactcgtgtacttcagcagtgtgattctcttcggtgcctgcatcgagggtgtg
gtgctccgggacaagtacggtgatggcgtcagcaggaacctggtggtaggcaccttggcc
tggccttcaccttgggtcatcgtggtcggctccttcttctcaacatgtggtgccggcctc
caaagtctcactggggcgccacgtttactgcaagccattgccaaggataacatcatcccc
ttcctccgggtgtttggccacgggaaagccaatggtgagccaacgtgggccctcctcctg
acagcgctcatcgctgagctgggcatcctcatcgcctcccttgacatggtggcccccatt
ctttccatgttctttctgatgtgttacctctttgtaaacttggcctgtgctgtgcagaca
cttctgaggacccccaactggcggccccggttcaagtactatcactgggcgttgtctttc
ctgggcatgagtctgtgcctggctctcatgtttgtctcctcctggtactacgccctagtg
gccatggtcatcgcaggcatgatctacaagtacatcgagtaccaaggggctgagaaggag
tggggtgatgggatccgaggcctgtccctgagtgccgcacgatatgcactgctgagacta
gaggaagggcctcctcacacgaagaactggcggcctcagctcctggtgctgctgaagtta
gacgaagatcttcatgtgaagtaccctcggctcctcacctttgcctcccaacttaaggct
gggaaaggcctgacaatcgttggctctgtcatccagggcagctttctggagagctatggg
gaagcccaggctgctgagcagacaatcaagaacatgatggagattgagaaagtaaaaggc
ttctgccaggtagtggtggccagcaaggttcgagaggggctggcccacctcatccagtct
tgcggcctgggtggcatgagacataactccgtggtgctgggctggccctatggctggcga
cagagtgaggacccacgtgcctggaagacctttatcgacactgtgcgctgcaccacagct
gcccacctggccctgctggtgccaaagaacatagctttctaccccagcaaccacgagcgc
tacctggagggccacattgatgtgtggtggatcgtgcatgacggaggcatgctgatgctg
ctgcccttcctgctgcgccagcataaggtttggaagaagtgccggatgcgcattttcacc
gtggcccagatggacgacaacagcatccagatgaagaaggatctggccatcttcctgtat
cacctccgcctggaagctgaagtggaggtggtagagatgcacaacagtgacatctcggcc
tacacctacgagcggacactgatgatggagcagcggtctcaaatgctgcgacagatgagg
ctgaccaaaacagagcgggatcgagaggcccagctggtgaaggacaggcactcggctctg
aggctagagagcctctactccgacgaggaggatgagtctgtgacaggcgctgacaagatc
cagatgacatggaccagagacaagtacatggctgaaccctgggaccccagccatgcccct
gacaacttccgggagctggtgcacattaagccggaccagtccaatgtgcggcgtatgcac
actgctgtgaagctcaatgaagtcattgtcacacgctcccatgatgcccgcctggtccta
ctgaacatgcccggcccccctaagaacagtgagggtgatgagaactacatggaattcctt
gaagtcctaaccgagggccttgaacgggtgttgttggtgcgtggtggtggccgggaagtc
atcaccatctattcttga

DBGET integrated database retrieval system