KEGG   Rattus norvegicus (rat): 29502
Entry
29502             CDS       T01003                                 

Gene name
Slc20a2
Definition
(RefSeq) sodium-dependent phosphate transporter 2 precursor
  KO
K14640  solute carrier family 20 (sodium-dependent phosphate transporter)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29502 (Slc20a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC20: Type III Na+-phosphate cotransporter
   29502 (Slc20a2)
SSDB
Motif
Pfam: PHO4
Other DBs
NCBI-GeneID: 29502
NCBI-ProteinID: NP_058919
RGD: 3699
Ensembl: ENSRNOG00000019490
UniProt: Q63488
Position
16
AA seq 656 aa
MAMDGYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSV
LLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVG
STIGFSLVAIGPKGVQWMELVKIVASWFISPLLSGFMSGVLFILIRMFILTKEDPVPNGL
QALPLFYAATIAINVFSIMYTGAPVLGLSLPIWAIALISFGVALLFAFFVWLFVCPWMKR
KIAGRLEKESALSRASDESLRKVQEAESPVFKELPGAKASDDSAVPLTSLAGEAAGASEG
TSAGNHPRASYGRALSMTHGSAKSPISNGTFGFEGHMRNDGHVYHTVHKDSGLYKDLLHK
IHVDKGPEEKPAQENNYRLLRRNNSYTCYTAAICGMPVHATFRASDTSSAPEDSEKLVGD
TVSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVEMRLASELTDPDQPHEDPAEDEKEEKD
SAEVHLLFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFY
GGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKV
GSVVAVGWIRSRKAVDWRLFRNIFIAWFVTVPVAGLFSAAIMALLMYICGFVSSSR
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggccatggatgggtatctgtggatggtcattttgggtttcattattgctttcatcctg
gcattttcagttggtgccaatgatgttgccaactcctttggaaccgcggtgggctctggc
gtggtgaccctgagacaggcatgcattctggcttcgatatttgaaaccaccggctctgtg
cttttgggagcgaaagtgggagagactatccggaagggcatcattgacgtgaacctctac
aatgagactgtggaaacgctcatggctggggaagtgagtgcaatggtcggctcagcggtc
tggcagttgatcgcgtccttcctgagactcccaatctcagggacacactgcatcgtgggc
tctaccattggcttctcgctcgtggccatcggcccaaagggagtgcagtggatggaactc
gtcaagatcgttgcctcctggttcatatccccacttctgtctggcttcatgtctggtgtg
ctgttcatcctgatcagaatgttcatcctaaccaaggaggaccctgttccaaacggtctc
caggcacttcctctgttttatgctgccactatagcaataaacgtcttctccatcatgtac
acaggagcaccagtgctgggcctgtcgctccccatctgggcaatagcgctcatctccttc
ggcgttgccctgctgttcgccttcttcgtgtggctgttcgtgtgtccgtggatgaagagg
aaaatagcgggcaggttagagaaggagagtgctctgtcccgcgcgtctgacgaaagcctc
aggaaggtacaggaagctgagtcccctgtctttaaggagcttcctggtgccaaagccagt
gatgacagcgctgtccccctcaccagtctggctggggaggctgcgggggcctcagaaggc
acgtcagcagggaaccacccccgggcttcctacggccgagcactttccatgactcacggc
tctgcaaagtcacccatctccaatggaacctttggcttcgaaggccacatgaggaatgac
ggtcacgtttatcatactgtacacaaagactcgggactctacaaagacttgctgcacaaa
atccatgtagacaagggccccgaggagaaaccagctcaggaaaacaactacaggctgctc
cggaggaacaacagctacacgtgctacacggcagccatctgcggcatgccggtgcacgcc
accttcagggcctcggacacctcctccgcccccgaggatagcgagaagctggtgggtgac
accgtgtcctattccaagaagaggctccgctacgacagctactccagctactgcaacgcg
gtggccgaggcggagatcgaggccgaagagggcggcgtggaaatgaggctggcctctgag
ctgaccgatcctgaccagcctcacgaggatcctgcggaagacgagaaggaggagaaggac
tccgcagaggtccacctgctcttccacttcctgcaagtcctcactgcctgctttgggtcc
tttgctcacggtggcaacgatgtgagcaatgctatcggtccccttgtggccctgtggctg
atatataaacaaggcggagttacacaagaagctgctactccagtctggctgctgttttat
gggggcgttggcatctgcacaggtctctgggtttggggcagaagagtgatccagaccatg
gggaaggatctcacacccatcacaccgtccagtggcttcactattgagctggcctctgcc
ttcaccgtggtgatcgcctccaacattgggcttcccgtcagcaccacacactgcaaggtg
ggctcagtggtagccgtgggctggatccgctcccggaaggctgtggactggcgcctcttc
cggaacatatttattgcctggttcgtgaccgtgccggtggccggacttttcagtgctgct
atcatggctctcctcatgtatatatgtggttttgtttcttccagtcggtaa

DBGET integrated database retrieval system