KEGG   Rattus norvegicus (rat): 29508
Entry
29508             CDS       T01003                                 

Gene name
Nfya, CBF-A
Definition
(RefSeq) nuclear transcription factor Y subunit alpha
  KO
K08064  nuclear transcription factor Y, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno05017  Spinocerebellar ataxia
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    29508 (Nfya)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    29508 (Nfya)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    29508 (Nfya)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29508 (Nfya)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    29508 (Nfya)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
NCBI-GeneID: 29508
NCBI-ProteinID: NP_036997
RGD: 70976
Ensembl: ENSRNOG00000012702
UniProt: P18576
Position
9q12
AA seq 341 aa
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
QQGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSV
PAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRH
AMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggagcagtatacagcaaatagcaatagttccacagagcagatcgtggtgcaggctggc
cagattcagcagcagcagcagggtggtgtcactgctgtccagctgcagactgaggcccag
gtggcatccgcctcaggccagcaagtccagaccctccaggtagttcaggggcagccatta
atggtgcaagtcagtggaggccagctgattacatcaactggccaacccatcatggtacag
gctgtgcctggtggacaaggccaaactatcatgcaagtacctgtgtctggaacacaaggt
ttacagcagatacagttggtaccccctggacagatccagatccagggcgggcaggctgtg
caggtgcaaggccagcagggacagacccagcagatcatcattcagcagccacagaccgcg
gtcaccgctggccagactcagacacaacaacagattgctgtccagggacagcaagtggcc
cagactgctgaagggcagactattgtctaccagccagttaatgcagatggcacaatcctc
cagcaaggcatgatcaccatcccagcagccagtttggcaggggcacagatcgttcagaca
ggagccaataccaacacaaccagtagtggacaagggactgtcactgtgacactgccagtg
gcagggaatgtggtcaactcaggaggaatggtcatgatggtaccaggggctggctctgtg
cctgctatccaaagaatccctttacctggggcagagatgctggaagaagagccgttgtat
gtgaatgccaaacagtatcaccgcatccttaagaggagacaagcgagggccaagctagag
gcagaagggaagatcccaaaggaaagaaggaaatacctccatgagtctcggcaccgacac
gccatggcacggaagcgtggggaagggggccgcttcttctctccaaaagaaaaggacagt
cctcacatgcaggatccaaaccaagctgatgaagaagccatgacacagatcatccgagtt
tcctaa

DBGET integrated database retrieval system