KEGG   Rattus norvegicus (rat): 29509Help
Entry
29509             CDS       T01003                                 

Gene name
Slc22a6, Oat1, Orctl1, Paht, Roat1
Definition
(RefSeq) solute carrier family 22 member 6
  KO
K08203  MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29509 (Slc22a6)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   29509 (Slc22a6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    29509 (Slc22a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 VIT1
Motif
Other DBs
NCBI-GeneID: 29509
NCBI-ProteinID: NP_058920
RGD: 69338
Ensembl: ENSRNOG00000018215
UniProt: O35956
Position
1q43
AA seq 551 aa AA seqDB search
MAFNDLLKQVGGVGRFQLIQVTMVVAPLLLMASHNTLQNFTAAIPPHHCRPPANANLSKD
GGLEAWLPLDKQGQPESCLRFTSPQWGPPFYNGTEANGTRVTEPCIDGWVYDNSTFPSTI
VTEWNLVCSHRAFRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
YAPNYTVYCVFRLLSGMSLASIAINCMTLNVEWMPIHTRAYVGTLIGYVYSLGQFLLAGI
AYAVPHWRHLQLVVSVPFFIAFIYSWFFIESARWYSSSGRLDLTLRALQRVARINGKQEE
GAKLSIEVLRTSLQKELTLSKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
QGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQMASLLLAGICILVNGIIPKSHT
IIRTSLAVLGKGCLASSFNCIFLYTGELYPTVIRQTGLGMGSTMARVGSIVSPLVSMTAE
FYPSMPLFIFGAVPVVASAVTALLPETLGQPLPDTVQDLKSRSRGKQNQQQQEQQKQMMP
LQASTQEKNGL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaatgacctcctgaaacaggtggggggcgtcggacgcttccagttgatccag
gtcaccatggtggttgctcccctactgctgatggcttcccacaacaccttgcagaacttc
actgccgctatcccccctcatcactgccgcccacctgccaatgccaatctcagcaaagat
ggaggtctggaggcctggctgcccctggacaagcaaggacaacccgaatcttgcctccgc
tttacttccccccagtggggaccacccttttacaatggcacagaagccaatggcaccaga
gtcacagagccctgcattgatggctgggtctatgacaacagcaccttcccttcaaccatc
gtgactgagtggaaccttgtgtgctctcatcgggctttccgccagctggcccagtccctg
tacatggtgggagtgctgctgggagccatggtgtttggctacctggcggacaggctgggc
cgccggaaggtgctgatcttgaactacctgcagacagctgtgtcgggaacctgtgcagcc
tatgcacccaactatactgtctactgcgttttccggctcctctcgggcatgtctttggct
agcattgcaatcaactgcatgacactaaatgtggaatggatgcctatccacacccgtgcc
tatgtgggcaccttgattggctatgtctacagcctgggccagttcctcctggctggcatc
gcctatgctgtgccccactggcgccacctgcagcttgtggtctctgtgccttttttcatt
gccttcatctactcttggttcttcattgagtcagcccgctggtactcctcctcaggaagg
ctggacctcaccctccgagccctgcagagagtggcccggatcaatgggaaacaagaagaa
ggggctaagctaagtatagaggtgctccggaccagcctgcagaaggaactgactctaagc
aaaggccaagcctcagccatggagctgctgcgctgccccacccttcgacacctcttcctc
tgtctctccatgctgtggtttgccactagctttgcctactacgggctggtcatggacctg
cagggctttggggtcagcatgtaccttatccaggtgattttcggtgccgtggacctgcct
gccaagtttgtatgcttcctagtcatcaactccatggggcgccggcctgcacagatggcc
tccctgctgctggcaggcatctgcatcctggtgaatggcataataccgaagagccatacg
atcattcgcacctccctggctgtgctagggaagggctgcctggcttcctctttcaactgc
atcttcctgtacaccggagagctgtaccccacagtgattcggcagacaggcctgggcatg
ggcagcaccatggcccgggtgggcagcattgtgagcccgctggtgagtatgactgcagag
ttctacccctccatgcctctcttcatcttcggcgctgtccctgtggtcgccagtgctgtc
actgccctgctgccagagaccttgggccagccgctgccagatacagtgcaggacctgaag
agcaggagcagaggaaagcagaatcaacagcagcaggaacagcagaagcagatgatgccg
ctccaggcctcaacacaagagaagaatggactttga

DBGET integrated database retrieval system