KEGG   Rattus norvegicus (rat): 295090Help
Entry
295090            CDS       T01003                                 

Gene name
Vom2r45, RGD1306812, Vmn2r5
Definition
(RefSeq) vomeronasal 2 receptor, 45
  KO
K04613  vomeronasal 2 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    295090 (Vom2r45)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    295090 (Vom2r45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 295090
NCBI-ProteinID: XP_001059752
RGD: 1306812
Position
2q31
AA seq 911 aa AA seqDB search
MASRKKCLILGLTVFLWVELYAQNEEQNVTCRLLRKFNLTGYVEAANHSMVIGGLFPIHS
RTIPTNDSDEEPVSAMCEGFNFRGFRWMKTMIHTIKEINGRKDILPNHTLGYQIFDTCFS
VSKAMETALVFLTGQEENKPNFRNSTGKYLVGIIGSGGSSLSVAASRILGLYYMPQVGYT
SSCSILSDKFQFPSFYRSIPSDKIQSEAMVNLIKHFGWVWVGAIAADDDYGKYGVKSFRE
KMESANLCVAFSETIPKVYSNEKMQKAVKAVKSSTAKVIVLFTTDIDLSPFVLEVVHHNI
TDRTWIASEAWITSALVAKPEYFPYFGGTIGFAIPRSVIPGLKEFLYDIHPSKDPKDVLT
IEFWQTAFNCTWPNSTVPYNVDHRVNMTGKEDRLYAMSNQLCTGEEKLEDLKNTYLDTSQ
LRITNNVKQAVYLMAYALDRLSNCDLLEEYSNSTACSHIPDFEPREMLPYFKKLKITTHD
GTEIELDNNGDIENGYYDILNWHLGNAGEVAFVKVGEYKFTSSKYELVLPKNSSLFWNTE
SSMLPDSVCTKLCAPGTRKGVRQGQPICCFDCIPCADGYVSEKQGQRECDPCGEDDWSNA
EKSKCVPKLVEFLAYEEALGFTLVILSIFGAIVVFAVTIVYVIHRHTPLVKANDRELSFL
IQMSLGITVLSSMLFIGKPSNWTCMARQVTLALGFCLCLSSTLGKTISLFFAYRISKSKT
RLISMHPVFRKLIVLFCVVGEIGVCAAYLVLEPPRMFKNIESQNVKIIFECNEGSIEFLC
AIFGFDVFLALLCFLTTFVARKLPDNYYEGKCITFGMLVFFIVWISFVPAYLSTKGKFKV
AVEIFAILASSYGLLGCIFLPKCFIILLRPKRNTDETVGGRVPTVDRSIQLTSASVSSEL
NSTTVSTVLDE
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggctagcagaaagaagtgcttgattctgggattgactgtatttttgtgggttgaatta
tatgctcaaaatgaagagcagaatgtgacatgcaggctgctgcgcaagtttaatctgact
ggatacgtagaggctgcaaaccactccatggttattggaggactatttcctattcactct
agaaccatcccaacaaatgactctgatgaggaacccgtatcagccatgtgcgaggggttt
aatttccggggtttccgctggatgaaaaccatgatccacaccatcaaggagattaatgga
aggaaggacattttgcccaaccacactctgggctaccagatctttgacacctgtttttct
gtctccaaagcaatggagactgctttggtatttcttacaggacaggaagaaaacaagccc
aattttagaaacagcactggaaaatatctggtaggaattattggatcaggaggctcatcc
ttgtcagttgctgcttcaagaattctggggttgtattacatgcctcaggttggttatact
tcttcctgctcaattcttagtgacaaattccagtttccatctttttatcgctcaataccc
agtgataagatccagtctgaggccatggtgaatcttatcaaacactttggttgggtctgg
gtaggtgctattgcagctgatgacgattatggaaaatatggagtaaaatcatttagggaa
aaaatggagagtgccaacctctgtgttgctttctctgaaaccattccaaaagtctactcc
aatgagaaaatgcaaaaagctgttaaggcggtaaaaagttccactgccaaagtcattgtg
ctttttacaactgacattgacctcagcccctttgtgctggaagtggttcatcacaacata
accgacaggacatggatagccagtgaagcctggattacctcagctcttgttgcaaagcct
gagtattttccttattttggaggaaccattggatttgcaatcccgagaagtgttatacca
ggattaaaagaatttctttatgatatacaccctagcaaggatccaaaggatgtcttgacc
attgaattctggcaaactgcttttaactgtacctggcccaacagcactgtgccttacaac
gtggaccacagagtgaatatgactggaaaagaagacagattatatgctatgtctaatcag
ctctgcaccggagaggagaagctggaggatctgaaaaatacctatctagatacatctcag
ctgagaattacaaacaatgtcaaacaagctgtgtatcttatggcttatgccctggatcgt
ttaagcaattgtgacttattggaagaatatagtaatagtacagcatgttcacatatacct
gactttgagcccagagagatgctgccttactttaagaaattgaaaattactacccatgat
ggaacagaaatagaacttgataacaatggagatatagaaaatggatattatgatatcctc
aattggcacttgggcaatgctggagaagttgcctttgtcaaggttggagaatacaaattc
acaagttcaaaatatgaacttgttcttccaaagaactcatcattgttttggaacactgaa
tcttcaatgcttccagattcagtctgcacaaaactgtgtgctccagggactcgaaagggg
gttcgacagggacaacccatatgctgctttgattgcatcccatgtgctgatggatatgtg
tcagagaaacaaggccaaagggaatgtgatccatgtggtgaagatgactggtccaatgca
gaaaagagcaagtgtgtgccaaagcttgtggaattccttgcttatgaagaggccctgggg
ttcacccttgtcatcctttccatatttggggcaattgtggtctttgcagtcaccattgtg
tatgtgatacacagacatactccattggtgaaagccaatgacagagagttgagtttcctc
attcagatgtctctgggaatcacagtgctatcatctatgttgttcataggaaagccatcc
aactggacctgcatggcccgccaggtcactctggcactgggcttttgcctttgtctgtct
tccactcttggaaagactatttcactcttttttgcctacaggatttccaaatccaaaacc
cggcttatatccatgcaccctgtttttcgaaaattaattgtgctgttctgtgttgtaggg
gagattggtgtatgtgcagcttacttggtgctggagcctccaaggatgttcaagaacatt
gaatctcaaaatgtaaagatcatctttgaatgtaatgaagggtctatagagtttctgtgt
gctatatttgggtttgatgtttttctggctctactgtgtttcctaacaacctttgtggct
cgcaagctgccagataactattatgaagggaaatgtatcacttttgggatgctggtcttt
ttcattgtctggatctcctttgtccctgcttacttgagcaccaaaggcaaattcaaagtt
gctgtggaaatatttgccattttggcatccagctatggcttgttaggctgtatatttctt
cccaagtgtttcattatcttgctgaggccaaagaggaacacggatgaaactgttggtgga
agagtccccactgttgacaggagcatccagctgacctcagcctctgtgagcagtgagctt
aacagcacaacagtgtcaactgttctggatgaataa

DBGET integrated database retrieval system