KEGG   Rattus norvegicus (rat): 295105Help
Entry
295105            CDS       T01003                                 

Gene name
Schip1
Definition
(RefSeq) schwannomin interacting protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SCHIP-1 IQCJ-SCHIP1 FEZ IQ
Motif
Other DBs
NCBI-GeneID: 295105
NCBI-ProteinID: NP_001094136
RGD: 1309962
Ensembl: ENSRNOG00000009276
UniProt: Q562A8
Position
2q32
AA seq 560 aa AA seqDB search
MRLEELKRLQNPLEQVDDGKYLLENHQLATDMENNIENYPLSLQPLESKVKIIQRAWREY
LQRQDPLEKRSPSPPSVSSDKLSSSVSMNTFSDSSTPDYREDGMDLGSDAGSSSSSSRAS
SQSNSTKVTPCSECKSSSSPGGSLDLVSALEDYEEPFPVYQKKVIDEWAPEEDGEEEEEE
DDRGYRDDRCPAREPGDVSARIGGSGSGNRSAATTMPSPMPNGNLHPHDPQDLRHNGNLV
IAGRPNASRVPRRPIQKTQPPGNRRGGRNRASGGLCLQPPDGGMRVPEEPPAPPMDWEAL
EKHLAGLQFREQEVRNQGQARTNSTSAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGK
PSLSSRLQSGMNLQICFVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEE
ESESLDDMDFLTRQKKLQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISE
CLMKRSLKPTDLRDMTIGQLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIE
DLTRHAESQQKHMAEKMPSK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcgactggaagaactaaaaagactacagaatcctttagaacaagttgatgatggaaaa
tatttgctcgagaatcaccagctggccacggatatggagaataacattgagaactatccc
ctcagcctacagcccttggaatccaaggtgaaaatcattcagcgagcatggcgagagtac
ttgcagaggcaggaccccctggagaagaggagcccatccccaccttctgtctcttcagac
aagctgagcagctctgtcagcatgaacaccttctccgacagcagcacacccgattaccga
gaggatgggatggatctaggcagtgacgccggcagcagcagcagcagcagccgcgccagc
tcacagtccaactccaccaaagtgaccccttgctccgagtgcaaatcctcatcgtcgccg
gggggcagcctggacttggtgtctgctctggaagactatgaagagcccttcccggtctac
cagaagaaggtgattgatgagtgggctccggaggaggacggggaggaggaggaagaggag
gacgatcgagggtatcgggatgaccgctgcccggcccgggagccgggggacgtaagcgcc
aggatcggcggcagcggcagcgggaacaggagcgccgccaccaccatgccttccccgatg
cctaacggcaacctccacccgcacgacccccaagacctcaggcacaatggcaacctggtg
atagccggccggccgaacgcctcccgggttccccggcgacccatccagaagacccagcct
ccaggaaaccggcgcggaggccggaaccgggcatctggggggctctgccttcagcctccg
gacggcgggatgcgcgtcccggaagaaccccctgcgcccccaatggactgggaggcgttg
gaaaagcatctggctgggctgcagttccgggagcaggaggtgcgaaatcagggtcaggcg
aggaccaactccacctctgcacagaagaatgagagagagtctatcagacagaagttggca
ctcggaagcttctttgacgatggccccggaatctataccagctgcagcaaaagcgggaag
ccaagcctttcctcgagactacaaagtgggatgaacctccagatatgctttgtcaacgac
agcggcagtgacaaggacagcgatgccgacgacagtaagactgagaccagcctggacacg
cccttgtcccccatgagcaagcagagttcttcctactctgatagagacaccaccgaggag
gaatctgaatccctggatgacatggacttccttacaaggcaaaagaagctacaagctgaa
gccaaaatggccctggccatggccaaaccaatggccaaaatgcaagtagaagtggaaaaa
cagaacaggaaaaagtctcccgtcgctgaccttctgcctcacatgcctcacataagcgaa
tgcttgatgaaaagaagcttaaagcccaccgacctgagagacatgactatcgggcagcta
caagtgatcgtcaatgaccttcactcccagattgagagtttgaatgaagagttggtccag
ctgctcctcattcgagatgagctgcacacagaacaagacgccatgctggtggacatagaa
gacttgactagacacgctgagagtcagcagaagcacatggctgagaaaatgccctcgaag
tga

DBGET integrated database retrieval system