KEGG   Rattus norvegicus (rat): 29513
Entry
29513             CDS       T01003                                 

Gene name
Mapk13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29513 (Mapk13)
   04015 Rap1 signaling pathway
    29513 (Mapk13)
   04370 VEGF signaling pathway
    29513 (Mapk13)
   04668 TNF signaling pathway
    29513 (Mapk13)
   04068 FoxO signaling pathway
    29513 (Mapk13)
   04071 Sphingolipid signaling pathway
    29513 (Mapk13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    29513 (Mapk13)
   04218 Cellular senescence
    29513 (Mapk13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29513 (Mapk13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29513 (Mapk13)
   04613 Neutrophil extracellular trap formation
    29513 (Mapk13)
   04620 Toll-like receptor signaling pathway
    29513 (Mapk13)
   04621 NOD-like receptor signaling pathway
    29513 (Mapk13)
   04622 RIG-I-like receptor signaling pathway
    29513 (Mapk13)
   04625 C-type lectin receptor signaling pathway
    29513 (Mapk13)
   04660 T cell receptor signaling pathway
    29513 (Mapk13)
   04658 Th1 and Th2 cell differentiation
    29513 (Mapk13)
   04659 Th17 cell differentiation
    29513 (Mapk13)
   04657 IL-17 signaling pathway
    29513 (Mapk13)
   04664 Fc epsilon RI signaling pathway
    29513 (Mapk13)
   04670 Leukocyte transendothelial migration
    29513 (Mapk13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    29513 (Mapk13)
   04914 Progesterone-mediated oocyte maturation
    29513 (Mapk13)
   04917 Prolactin signaling pathway
    29513 (Mapk13)
   04926 Relaxin signaling pathway
    29513 (Mapk13)
   04935 Growth hormone synthesis, secretion and action
    29513 (Mapk13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29513 (Mapk13)
  09156 Nervous system
   04728 Dopaminergic synapse
    29513 (Mapk13)
   04723 Retrograde endocannabinoid signaling
    29513 (Mapk13)
   04722 Neurotrophin signaling pathway
    29513 (Mapk13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29513 (Mapk13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    29513 (Mapk13)
  09159 Environmental adaptation
   04714 Thermogenesis
    29513 (Mapk13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    29513 (Mapk13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    29513 (Mapk13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29513 (Mapk13)
   05161 Hepatitis B
    29513 (Mapk13)
   05171 Coronavirus disease - COVID-19
    29513 (Mapk13)
   05163 Human cytomegalovirus infection
    29513 (Mapk13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29513 (Mapk13)
   05169 Epstein-Barr virus infection
    29513 (Mapk13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29513 (Mapk13)
   05135 Yersinia infection
    29513 (Mapk13)
   05133 Pertussis
    29513 (Mapk13)
   05152 Tuberculosis
    29513 (Mapk13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    29513 (Mapk13)
   05140 Leishmaniasis
    29513 (Mapk13)
   05142 Chagas disease
    29513 (Mapk13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29513 (Mapk13)
   05020 Prion disease
    29513 (Mapk13)
   05022 Pathways of neurodegeneration - multiple diseases
    29513 (Mapk13)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29513 (Mapk13)
   05418 Fluid shear stress and atherosclerosis
    29513 (Mapk13)
   05415 Diabetic cardiomyopathy
    29513 (Mapk13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    29513 (Mapk13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    29513 (Mapk13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29513 (Mapk13)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     29513 (Mapk13)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   29513 (Mapk13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 RIO1 APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 29513
NCBI-ProteinID: NP_062104
RGD: 3045
Ensembl: ENSRNOG00000000515
Vega: OTTRNOG00000001972
UniProt: Q32Q45
Position
20
AA seq 366 aa
MSLIRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMHHENVIGLLDVYTPATSVRNFQDFYLVMPFMQTDLQKIMGM
EFSEEKVQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAVDLLDKMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQQPFDDALEREKLSVDEWKQHIYKEIANFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcctcattcggaaaaggggcttctacaagcaggacatcaacaagactgcctgggag
ctgcccaagacctacctggcgcccgcgcacgtcggcagcggggcctatggcgcggtgtgc
tcggccatcgacaagcggacaggggagaaggtggccatcaagaagctgagccggcccttc
cagtcggagatctttgccaagcgcgcttaccgcgaactcctgctgttgaagcacatgcac
catgagaacgtcattgggcttctggatgtctacacacctgccacttccgttcgaaacttc
caagatttctacctggtgatgcctttcatgcagaccgacctgcagaagataatggggatg
gagttcagtgaggagaaggtccagtatttggtgtaccagatgctcaaaggtctaaagtac
atccactcagctggtatcgttcacagggacctgaagccaggcaacctggccgtgaatgaa
gactgtgagctgaagatcctggactttgggctggcacgccacacggacgcggagatgact
ggctatgtggtgacccgctggtaccgggctcctgaggtgatcctcagctggatgcattac
aaccagacggtggatatctggtctgttggctgcatcatggccgagatgctaaccggaaag
acactcttcaagggtaaggactacctggaccagctgacccagatcctgaaagtgactggg
gtgccaggtgccgagttcgtgcagaagctgaaagacaaggcggccaaatcctacattcag
tccctgccccagagccccaagaaggatttcacacagcttttcccacgcgccagcccgcaa
gctgtagacctgctggacaagatgctggagctggacgtggacaagcgtctgaccgctgct
caggcactcgctcaccccttctttgaacccttccgggaccctgaggaggagacagaggcc
cagcagccatttgatgatgccttagagcgggagaaactcagcgtggacgaatggaaacaa
cacatctacaaagagatcgccaacttcagtcccatagcccggaaggactcgaggcgacga
agtgggatgaagctgcagtga

KEGG   Rattus norvegicus (rat): 60352
Entry
60352             CDS       T01003                                 

Gene name
Mapk12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60352 (Mapk12)
   04015 Rap1 signaling pathway
    60352 (Mapk12)
   04370 VEGF signaling pathway
    60352 (Mapk12)
   04668 TNF signaling pathway
    60352 (Mapk12)
   04068 FoxO signaling pathway
    60352 (Mapk12)
   04071 Sphingolipid signaling pathway
    60352 (Mapk12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    60352 (Mapk12)
   04218 Cellular senescence
    60352 (Mapk12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    60352 (Mapk12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    60352 (Mapk12)
   04613 Neutrophil extracellular trap formation
    60352 (Mapk12)
   04620 Toll-like receptor signaling pathway
    60352 (Mapk12)
   04621 NOD-like receptor signaling pathway
    60352 (Mapk12)
   04622 RIG-I-like receptor signaling pathway
    60352 (Mapk12)
   04625 C-type lectin receptor signaling pathway
    60352 (Mapk12)
   04660 T cell receptor signaling pathway
    60352 (Mapk12)
   04658 Th1 and Th2 cell differentiation
    60352 (Mapk12)
   04659 Th17 cell differentiation
    60352 (Mapk12)
   04657 IL-17 signaling pathway
    60352 (Mapk12)
   04664 Fc epsilon RI signaling pathway
    60352 (Mapk12)
   04670 Leukocyte transendothelial migration
    60352 (Mapk12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    60352 (Mapk12)
   04914 Progesterone-mediated oocyte maturation
    60352 (Mapk12)
   04917 Prolactin signaling pathway
    60352 (Mapk12)
   04926 Relaxin signaling pathway
    60352 (Mapk12)
   04935 Growth hormone synthesis, secretion and action
    60352 (Mapk12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    60352 (Mapk12)
  09156 Nervous system
   04728 Dopaminergic synapse
    60352 (Mapk12)
   04723 Retrograde endocannabinoid signaling
    60352 (Mapk12)
   04722 Neurotrophin signaling pathway
    60352 (Mapk12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    60352 (Mapk12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    60352 (Mapk12)
  09159 Environmental adaptation
   04714 Thermogenesis
    60352 (Mapk12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    60352 (Mapk12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    60352 (Mapk12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    60352 (Mapk12)
   05161 Hepatitis B
    60352 (Mapk12)
   05171 Coronavirus disease - COVID-19
    60352 (Mapk12)
   05163 Human cytomegalovirus infection
    60352 (Mapk12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    60352 (Mapk12)
   05169 Epstein-Barr virus infection
    60352 (Mapk12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    60352 (Mapk12)
   05135 Yersinia infection
    60352 (Mapk12)
   05133 Pertussis
    60352 (Mapk12)
   05152 Tuberculosis
    60352 (Mapk12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    60352 (Mapk12)
   05140 Leishmaniasis
    60352 (Mapk12)
   05142 Chagas disease
    60352 (Mapk12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    60352 (Mapk12)
   05020 Prion disease
    60352 (Mapk12)
   05022 Pathways of neurodegeneration - multiple diseases
    60352 (Mapk12)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    60352 (Mapk12)
   05418 Fluid shear stress and atherosclerosis
    60352 (Mapk12)
   05415 Diabetic cardiomyopathy
    60352 (Mapk12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    60352 (Mapk12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    60352 (Mapk12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    60352 (Mapk12)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     60352 (Mapk12)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   60352 (Mapk12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Haspin_kinase Kinase-like UvrD_C
Other DBs
NCBI-GeneID: 60352
NCBI-ProteinID: NP_068514
RGD: 70975
Ensembl: ENSRNOG00000031233
UniProt: Q63538
Position
7
AA seq 367 aa
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK
VTGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLEKMLVLDAEQRV
TAAEALAHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR
VPKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctccccgccacccgcccgcaagggcttttaccgccaggaggtgaccaaaacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgttggctctggtgcctatggtgca
gtgtgctctgcagtagacagccgcactggcaacaaggtggccatcaagaagttgtaccgg
cccttccagtcggagctgtttgccaagcgcgcctacagagagttgcgcctcctcaaacac
atgcgccacgagaacgtcattgggctgctggatgtgttcactcccgatgagactctggat
gacttcacagacttctacctggtgatgccattcatgggcactgacctgggcaagctcatg
aagcacgagactctgagtgaagacagaatccagtttcttgtgtatcagatgctgaagggg
ctgaagtatatccacgctgccggcgtcatccacagggacttgaaacctggaaacctggct
gtgaacgaggactgtgagctgaagatcctagattttggccttgccaggcaggcggacagt
gagatgacaggatatgtggtaacccggtggtatcgggcaccagaggtcatcttgaattgg
atgcgttacacacagacagtggacatttggtctgttggctgcatcatggcagagatgatt
actggaaagatcctgttcaaaggcaatgaccacctggaccagctgaaggagatcatgaaa
gtcacagggacaccccctcctgagtttgtacagaagctacagagtgctgaggccaagaac
tacatggaaggcctccctgagttggaaaagaaggattttgcttctgtcctgaccaatgca
agccctcaggccgtgaatctcctggaaaagatgctggtgttggatgcggaacagcgggtg
acagcagctgaggcattagcccacccatactttgagtcccttcgggacactgaggatgag
cccaaggcccagaaatatgatgactcctttgatgacgtagaccgcacccttgaggaatgg
aagcgtgttacgtataaggaagtgctcagcttcaagcctcccaggcagctaggagccaga
gttccaaaggagacagctctgtga

KEGG   Rattus norvegicus (rat): 689314
Entry
689314            CDS       T01003                                 

Gene name
Mapk11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    689314 (Mapk11)
   04015 Rap1 signaling pathway
    689314 (Mapk11)
   04370 VEGF signaling pathway
    689314 (Mapk11)
   04668 TNF signaling pathway
    689314 (Mapk11)
   04068 FoxO signaling pathway
    689314 (Mapk11)
   04071 Sphingolipid signaling pathway
    689314 (Mapk11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    689314 (Mapk11)
   04218 Cellular senescence
    689314 (Mapk11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    689314 (Mapk11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    689314 (Mapk11)
   04613 Neutrophil extracellular trap formation
    689314 (Mapk11)
   04620 Toll-like receptor signaling pathway
    689314 (Mapk11)
   04621 NOD-like receptor signaling pathway
    689314 (Mapk11)
   04622 RIG-I-like receptor signaling pathway
    689314 (Mapk11)
   04625 C-type lectin receptor signaling pathway
    689314 (Mapk11)
   04660 T cell receptor signaling pathway
    689314 (Mapk11)
   04658 Th1 and Th2 cell differentiation
    689314 (Mapk11)
   04659 Th17 cell differentiation
    689314 (Mapk11)
   04657 IL-17 signaling pathway
    689314 (Mapk11)
   04664 Fc epsilon RI signaling pathway
    689314 (Mapk11)
   04670 Leukocyte transendothelial migration
    689314 (Mapk11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    689314 (Mapk11)
   04914 Progesterone-mediated oocyte maturation
    689314 (Mapk11)
   04917 Prolactin signaling pathway
    689314 (Mapk11)
   04926 Relaxin signaling pathway
    689314 (Mapk11)
   04935 Growth hormone synthesis, secretion and action
    689314 (Mapk11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    689314 (Mapk11)
  09156 Nervous system
   04728 Dopaminergic synapse
    689314 (Mapk11)
   04723 Retrograde endocannabinoid signaling
    689314 (Mapk11)
   04722 Neurotrophin signaling pathway
    689314 (Mapk11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    689314 (Mapk11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    689314 (Mapk11)
  09159 Environmental adaptation
   04714 Thermogenesis
    689314 (Mapk11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    689314 (Mapk11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    689314 (Mapk11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    689314 (Mapk11)
   05161 Hepatitis B
    689314 (Mapk11)
   05171 Coronavirus disease - COVID-19
    689314 (Mapk11)
   05163 Human cytomegalovirus infection
    689314 (Mapk11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    689314 (Mapk11)
   05169 Epstein-Barr virus infection
    689314 (Mapk11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    689314 (Mapk11)
   05135 Yersinia infection
    689314 (Mapk11)
   05133 Pertussis
    689314 (Mapk11)
   05152 Tuberculosis
    689314 (Mapk11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    689314 (Mapk11)
   05140 Leishmaniasis
    689314 (Mapk11)
   05142 Chagas disease
    689314 (Mapk11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    689314 (Mapk11)
   05020 Prion disease
    689314 (Mapk11)
   05022 Pathways of neurodegeneration - multiple diseases
    689314 (Mapk11)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    689314 (Mapk11)
   05418 Fluid shear stress and atherosclerosis
    689314 (Mapk11)
   05415 Diabetic cardiomyopathy
    689314 (Mapk11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    689314 (Mapk11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    689314 (Mapk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    689314 (Mapk11)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     689314 (Mapk11)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   689314 (Mapk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 689314
NCBI-ProteinID: NP_001103002
RGD: 1309340
Ensembl: ENSRNOG00000006984
UniProt: A0A0G2KB06
Position
7
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLETSQLPGTH
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggtccgcgcgcgggattctaccggcaagagctgaacaaaacagtatgggaggtg
ccgcagcggctgcagggcctacgcccggtgggctccggcgcctacggctcggtctgttcg
gcctacgacgcacggctgcgccagaaggtggctgtgaagaagctgtctcgccctttccaa
tcgctgatccacgcgaggaggacataccgtgagctacgcctactcaaacacctgaagcac
gagaacgtcataggacttttggacgtcttcacgccggccacatccatcgaggatttcagc
gaagtgtacctcgtgaccaccctgatgggcgctgacctgaataacatcgtcaagtgtcag
gccctgagcgatgagcatgttcagttccttgtctaccagctgctgcgtgggctgaagtat
atccactcggcgggcatcatccaccgggacctgaagcccagcaatgtagcagtgaatgag
gactgcgagctgaggatcctggactttgggctggcacgccaggctgatgaggagatgact
ggatatgtggccacacggtggtaccgggctccagagatcatgctgaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctccaaggaaag
gccctctttcctggaaatgactacatcgaccagctgaagcggatcatggaggtggtgggc
acacccagccctgaggttctggcaaagatatcctcggagcatgcccggacatacatccag
tctctgcctcccatgccccagaaggacctcagcagtgtcttccatggggccaaccctctg
gctgtagacctccttggaagaatgctggtgctagacagtgaccagagagtcagtgcggcc
gaagccttggcccatgcatacttcagccagtaccatgaccctgacgacgagccagaggcc
gagccctatgatgaaagtgttgaggccaaggagcgcaccctggaggagtggaaggagctt
acttaccaggaagtccttagcttcaagcccctggaaacatcgcagctccctggcacccat
gaaattgagcagtga

KEGG   Rattus norvegicus (rat): 81649
Entry
81649             CDS       T01003                                 

Gene name
Mapk14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81649 (Mapk14)
   04015 Rap1 signaling pathway
    81649 (Mapk14)
   04370 VEGF signaling pathway
    81649 (Mapk14)
   04668 TNF signaling pathway
    81649 (Mapk14)
   04068 FoxO signaling pathway
    81649 (Mapk14)
   04071 Sphingolipid signaling pathway
    81649 (Mapk14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    81649 (Mapk14)
   04218 Cellular senescence
    81649 (Mapk14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    81649 (Mapk14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    81649 (Mapk14)
   04613 Neutrophil extracellular trap formation
    81649 (Mapk14)
   04620 Toll-like receptor signaling pathway
    81649 (Mapk14)
   04621 NOD-like receptor signaling pathway
    81649 (Mapk14)
   04622 RIG-I-like receptor signaling pathway
    81649 (Mapk14)
   04625 C-type lectin receptor signaling pathway
    81649 (Mapk14)
   04660 T cell receptor signaling pathway
    81649 (Mapk14)
   04658 Th1 and Th2 cell differentiation
    81649 (Mapk14)
   04659 Th17 cell differentiation
    81649 (Mapk14)
   04657 IL-17 signaling pathway
    81649 (Mapk14)
   04664 Fc epsilon RI signaling pathway
    81649 (Mapk14)
   04670 Leukocyte transendothelial migration
    81649 (Mapk14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    81649 (Mapk14)
   04914 Progesterone-mediated oocyte maturation
    81649 (Mapk14)
   04917 Prolactin signaling pathway
    81649 (Mapk14)
   04926 Relaxin signaling pathway
    81649 (Mapk14)
   04935 Growth hormone synthesis, secretion and action
    81649 (Mapk14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81649 (Mapk14)
  09156 Nervous system
   04728 Dopaminergic synapse
    81649 (Mapk14)
   04723 Retrograde endocannabinoid signaling
    81649 (Mapk14)
   04722 Neurotrophin signaling pathway
    81649 (Mapk14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    81649 (Mapk14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    81649 (Mapk14)
  09159 Environmental adaptation
   04714 Thermogenesis
    81649 (Mapk14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    81649 (Mapk14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    81649 (Mapk14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    81649 (Mapk14)
   05161 Hepatitis B
    81649 (Mapk14)
   05171 Coronavirus disease - COVID-19
    81649 (Mapk14)
   05163 Human cytomegalovirus infection
    81649 (Mapk14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    81649 (Mapk14)
   05169 Epstein-Barr virus infection
    81649 (Mapk14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81649 (Mapk14)
   05135 Yersinia infection
    81649 (Mapk14)
   05133 Pertussis
    81649 (Mapk14)
   05152 Tuberculosis
    81649 (Mapk14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    81649 (Mapk14)
   05140 Leishmaniasis
    81649 (Mapk14)
   05142 Chagas disease
    81649 (Mapk14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    81649 (Mapk14)
   05020 Prion disease
    81649 (Mapk14)
   05022 Pathways of neurodegeneration - multiple diseases
    81649 (Mapk14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81649 (Mapk14)
   05418 Fluid shear stress and atherosclerosis
    81649 (Mapk14)
   05415 Diabetic cardiomyopathy
    81649 (Mapk14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    81649 (Mapk14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    81649 (Mapk14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81649 (Mapk14)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     81649 (Mapk14)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   81649 (Mapk14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 81649
NCBI-ProteinID: NP_112282
RGD: 70496
Ensembl: ENSRNOG00000000513
Vega: OTTRNOG00000001971
UniProt: Q56A33
Position
20
AA seq 360 aa
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcgcaggagaggcccacgttctaccggcaggagctgaacaagaccgtctgggaggtg
cccgagcgataccagaacctgtccccggtgggctcgggagcctacggctcggtgtgtgct
gcttttgatacaaagacgggacatcgtgtggcagtgaagaagctgtcgagaccgtttcag
tccatcattcacgccaaaaggacctacagggagctgcggctgctgaagcacatgaagcac
gagaatgtgattggtctgttggatgtgtttacacctgcaaggtccctggaggaattcaac
gatgtgtacctggtgacccatctcatgggggcagacctgaacaacatcgtgaagtgtcag
aagcttaccgatgaccacgttcagtttcttatctaccagatcctgcgagggctgaagtat
atacactcggctgacataatccacagggacctaaagcccagcaacctcgctgtgaatgaa
gactgtgagctgaagattctggattttgggctggctcggcacactgatgacgaaatgacc
ggctacgtggctacccggtggtacagagcccccgagattatgctgaattggatgcactac
aaccagacagtggatatttggtccgtgggctgcatcatggctgagctgttgaccggaaga
acgttgtttcctggtacagaccatattaaccagcttcagcagataatgcgtctgacgggg
acaccccctgcttatctcattaacaggatgccaagccatgaggcaagaaactacattcag
tctctggcccagatgccgaagatgaacttcgcaaatgtatttattggtgccaatcccctg
gctgtcgacctgctggaaaagatgctggttttggactcggataagaggatcacagcagcc
caagctcttgcgcatgcctactttgctcagtaccacgaccctgatgatgagccagtggct
gacccttatgaccagtcctttgaaagcagggacctccttatagacgaatggaagagcctg
acctacgatgaagtcattagctttgtgccaccgccccttgaccaagaagaaatggagtcc
tga

DBGET integrated database retrieval system