KEGG   Rattus norvegicus (rat): 29515
Entry
29515             CDS       T01003                                 

Gene name
Atn1, Drpla
Definition
(RefSeq) atrophin 1
  KO
K05626  atrophin-1 (dentatorubral-pallidoluysian atrophy protein)
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Atrophin-1
Other DBs
NCBI-GeneID: 29515
NCBI-ProteinID: NP_058924
RGD: 61832
Ensembl: ENSRNOG00000060594
UniProt: G3V7W3
Position
4q42
AA seq 1184 aa
MKTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAKKARVE
ETSTPKANKQGRSEEISESESEETSAPKKTKTEELPRPQSPSDLDSLDGRSINDDGSSDP
RDIDQDNRSTSPSIYSPGSVENDSDSSSGLSQGPARPYHPPPLFPPSPPPPDSIPRQPES
GFEPHPSVPPTGYHAPMEPPTSRLFQGPPPGAPPPHPQLYPGSAGGGVLSGPPMGPKGGA
AASSVGPPSGGKQHPPPTTPIPISSSGASGAPPAKPPNTPVGAGNLPSAPPPATFPHVTP
NLPPPPALRPLNNASASPPGMGAQPIPGHLPSPHAMGQGMSGLPPGPEKGPTLAPSPHPL
PPASSSAPGPPMRYPYSSCSSSSVAASSSSSAATSQYPASQTLPSYPHSFPPPTSMSVSN
QPPKYTQPSLPSQAVWSQGPPPPPPYGRLLPNNNTHPGPFPPTGGQSTAHPPAPAHHHHQ
QQQQPQPQPQPQPQQHHHGNSGPPPPGAYPHPLESSNSHHAHPYNMSPSLGSLRPYPPGP
AHLPPSHGQVSYSQAGPNGPPVSSSSNSSGSSSQAAYSCSHPSSSQGPQGASYPFPPVPP
ITTSSATLSTVIATVASSPAGYKTASPPGPPQYSKRAPSPGSYKTATPPGYKPGSPPSFR
TGTPPGYRGTSPPAGPGTFKPGSPTVGPGPLPPAGPSSLSSLPPPPAAPTTGPPLTATQI
KQEPAEEYETPESPVPPARSPSPPPKVVDVPSHASQSARFNKHLDRGFNSCARSDLYFVP
LEGSKLAKKRADLVEKVRREAEQRAREEKEREREREREKEREREKERELERSVKLAQEGR
APVECPSLGPVPHRPPFEPGSAVATVPPYLGPDTPALRTLSEYARPHVMSPGNRNHPFYV
PLGAVDPGLLGYNVPALYSSDPAAREREREARERDLRDRLKPGFEVKPSELEPLHGVPGP
GLDPFPRHGGLALQPGPPGLHPFPFHPSLGPLERERLALAAGPALRPDMSYAERLAAERQ
HAERVAALGNDPLARLQMLNVTPHHHQHSHIHSHLHLHQQDAIHAASASVHPLIDPLASG
SHLTRIPYPAGTLPNPLLPHPLHENEVLRHQLFAAPYRDLPASLSAPMSAAHQLQAMHAQ
SAELQRLALEQQQWLHAHHPLHSVPLPAQEDYYSHLKKESDKPL
NT seq 3555 nt   +upstreamnt  +downstreamnt
atgaagacacgacagaataaagactcgatgtcaatgaggagtggacggaagaaagaggcc
cccgggccccgggaagagctgagatcgaggggccgggcctcccctggaggggtcagcacg
tccagcagtgatggcaaagccgagaaatccaggcagacagccaagaaggcccgagtagag
gagacctctaccccaaaagccaacaagcagggccggagcgaggagatctcagagagtgaa
agcgaagagaccagtgcgcccaaaaagaccaagaccgaggagcttccgcgcccacagtct
ccctcggatctggacagcttagatggccgcagcatcaacgatgacggcagcagtgaccct
agagatatagaccaggacaaccgaagcacatcccccagcatctacagccctggcagtgtg
gaaaatgactcggattcatcctctggcctgtcccagggcccggctcgcccctaccaccca
cctccactctttcctccttcccctccaccaccagacagcattccccgacagccagagtct
ggctttgaaccgcacccttctgtgccgcctactggatatcatgctccaatggagcccccc
acatctcggttattccagggcccacctcctggagctcctcccccacacccacagctctac
cctgggagtgctggtggaggtgttttatctggaccccccatgggtcccaaagggggagca
gccgcctcctcagtgggtccccctagtgggggcaagcagcaccccccacccactacccca
attccaatatcaagctctggggccagtggcgctcctccagcaaagccccccaatactcca
gtgggtgctgggaacttaccttctgctccaccaccagctactttcccccacgtgacacca
aacctgcctcctccacctgccctgagacccctcaacaatgcctcagcctctcctcctggc
atgggggctcagccaatccctgggcatctgccctctccccatgccatggggcagggtatg
agtggacttcctcctggcccagagaagggcccaaccctggccccctctccccacccttta
cccccggcttcttcctccgctcctgggcccccaatgcggtacccgtattcatcctgctcc
agtagctctgttgcagcgtcttctagttcctccgccgccacctcccagtacccagcttcc
cagaccctgcccagttaccctcactccttccccccaccaacaagtatgtctgtctctaat
cagccacccaagtacacccagccttctctcccatcccaggctgtgtggagccagggccca
cctcctcctcctccttatggccgcctcttgcccaacaacaacactcatccgggccctttc
cctcctaccgggggtcaatccacagcccacccgccagcccctgcacatcaccatcaccag
cagcagcagcagccacagccacagccacagccacagccgcaacaacatcatcatggaaac
tctgggccccctccacctggggcatatcctcaccccctagagagcagtaactcccaccat
gcacacccttacaacatgtcaccctccctggggtctttgaggccctacccaccagggcca
gcacacctgcctccgtctcatggccaggtgtcttatagccaagcaggtcccaatggtccc
ccggtttcttcttcttccaactcttccgggtcttcgtctcaagccgcctattcatgctca
cacccttcttcatcccagggcccccaaggggcatcctaccccttcccaccagttcctcca
atcaccacctcctcagctactctttccactgtcatcgccaccgtggcttcctcgccagca
ggttataagacagcctcaccacctggcccccctcagtacagcaagagagccccatcccca
gggtcctacaagacagccaccccgcctggatacaagccagggtcaccaccgtccttcaga
acagggaccccacctggctatcgaggcacctctccgccagcaggcccagggaccttcaag
ccaggttcacccaccgtggggccggggcccctaccacccgcggggccttcaagtttgtca
tctctgcctccaccacccgcggccccgactacagggccgcccctgactgccacgcagatc
aaacaggaaccagctgaagagtatgaaacccccgagagtccggtgcctccggctcgcagc
ccctcgccccctcctaaggtggtggacgtgcctagccatgccagccagtcagccaggttc
aataagcacctggaccgtggcttcaactcgtgcgcgcgcagcgacctgtactttgtgccg
ctggagggatccaagctggccaagaagcgcgcggacctggtggagaaagtgcggcgcgag
gccgagcagcgcgcgcgcgaagaaaaagagcgcgagcgcgagcgggaacgtgagaaggag
cgcgagcgcgagaaagagcgcgagctggagcgcagtgtgaaattggcccaggagggccgt
gctccagtggagtgcccgtccctgggtccagtgccccatcggcctccctttgaacctggc
agcgctgtggctaccgtgcccccttacctgggtcctgatactccagccctgcgcactctc
agtgaatacgcccgacctcatgtcatgtctcctggcaatcgcaaccacccattctatgtg
cccttgggggcagtggacccggggcttctgggttacaatgtcccagccctgtacagcagc
gacccagctgcccgagaacgggagcgggaagcccgtgaacgtgacctccgtgaccggctc
aagcctggctttgaggtgaaacctagtgagctggaacccctacatggggtccccgggcca
ggcctggatcccttcccccgacacgggggcctggctctacaacctgggccacctggcctg
catcctttcccttttcatccgagcctggggcccctggaacgagaacggctagcgctggca
gctgggccagccctgcgtcctgacatgtcttatgctgagcggttggcagctgaaaggcag
catgcagaaagggtggcagccctgggcaatgacccactagcccggctgcagatgctcaac
gtgactccccatcatcaccagcactcccacatccactctcacctacacctgcaccagcag
gatgccatccatgcggcctccgcctcggtgcaccctctcattgaccccctggcctcaggg
tctcaccttacccggatcccctacccagctgggaccctccctaatccccttcttcctcac
cctctgcacgagaacgaagttcttcgtcaccagctctttgctgccccttaccgggaccta
ccggcctctctatctgcgccaatgtcagccgcccatcagctgcaggccatgcacgcacag
tcagccgagctgcagcgcttggcactggaacagcaacagtggctgcacgctcatcaccca
ttgcacagcgtgccgctgcctgcccaggaggactactacagtcacctgaagaaggagagt
gacaagccgctgtag

DBGET integrated database retrieval system