KEGG   Rattus norvegicus (rat): 29516
Entry
29516             CDS       T01003                                 

Gene name
Pde3b
Definition
(RefSeq) cGMP-inhibited 3',5'-cyclic phosphodiesterase B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04371  Apelin signaling pathway
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04922  Glucagon signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    29516 (Pde3b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    29516 (Pde3b)
   04024 cAMP signaling pathway
    29516 (Pde3b)
   04022 cGMP-PKG signaling pathway
    29516 (Pde3b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    29516 (Pde3b)
   04922 Glucagon signaling pathway
    29516 (Pde3b)
   04923 Regulation of lipolysis in adipocytes
    29516 (Pde3b)
   04914 Progesterone-mediated oocyte maturation
    29516 (Pde3b)
   04924 Renin secretion
    29516 (Pde3b)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    29516 (Pde3b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     29516 (Pde3b)
SSDB
Motif
Pfam: PDEase_I Sigma70_ner CDC45 Autophagy_act_C
Other DBs
NCBI-GeneID: 29516
NCBI-ProteinID: NP_058925
RGD: 61943
Ensembl: ENSRNOG00000011417
UniProt: Q63085
Position
1
AA seq 1111 aa
MRKDERERDTPAMRSPPPPPPPATATAASPPESLRNGYVKSCVSPLRQDPPRSFFFHLCR
FCNVEPPAASLRAGARLSLAALAAFVLAALLGAGPERWAAAATGLRTLLSACSLSLSPLF
SIACAFFFLTCFLTRAQRGPDRGAGSWWLLALPACCYLGDFAAWQWWSWLRGEPAAAAAG
RLCLVLSCVGLLTLAPRVRLRHGVLVLLFAGLVWWVSFSGLGALPPALRPLLSCLVGGAG
CLLALGLDHFFHVRGASPPPRSASTADEKVPVIRPRRRSSCVSLGESAAGYYGSGKMFRR
PSLPCISREQMILWDWDLKQWCKPHYQNSGGGNGVDLSVLNEARNMVSDLLIDPSLPPQV
ISSLRSISSLMGAFSGSCRPKINSFTPFPGFYPCSEVEDPVEKGDRKLHKGLSSKPSFPT
AQLRRSSGASGLLTSEHHSRWDRSGGKRPYQELSVSSHGCHLNGPFSSNLMTIPKQRSSS
VSLTHHAGLRRAGALPSPSLLNSSSHVPVSAGCLTNRSPVGFLDTSDFLTKPSVTLHRSL
GSVSSAADFHQYLRNSDSSLCSSCGHQILKYVSTCEPDGTDHHNEKSGEEDSTVFSKERL
NIVETQEEETVKEDCRELFLEGDDHLMEEAQQPNIDQEVLLDPMLVEDYDSLIEKMSNWN
FQIFELVEKMGEKSGRILSQVMYTLFQDTGLLETFKIPTQEFMNYFRALENGYRDIPYHN
RVHATDVLHAVWYLTTRPIPGLQQLHNNHETETKADSDARLSSGQIAYLSSKSCCIPDKS
YGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASA
WNLYLSRPEYNFLLNLDHMEFKRFRFLVIEAILATDLKKHFEFLAEFNAKANDVNSNGIE
WSSENDRLLVCQVCIKLADINGPAKDRDLHLRWTEGIVNEFYEQGDEEATLGLPISPFMD
RSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWIEAEEGDDTESDDDDDDDDDDDDDD
DDDDEELDSDDEETEDNLNPKPQRRKGRRRIFCQLMHHLTENHKIWKEIIEEEEKCKAEG
NKLQVDNASLPQADEIQVIEEADEEEEQMFE
NT seq 3336 nt   +upstreamnt  +downstreamnt
atgaggaaggacgagcgcgagcgggacacgccagccatgaggtccccgccgccgccgccg
ccgccggccacggccacggccgcctcgccccccgagagcctgcgcaacggctacgtgaag
agctgcgtgagcccgctgcggcaggaccctccgcgcagcttcttcttccacctctgccgc
ttctgcaacgtggagccgccggcggcctcgctccgcgccggggcacgcctctcgctcgcc
gctctggccgcctttgtcctggccgcgctgctgggcgcggggcccgagcgctgggcggcc
gcggcgaccgggcttcggacgctgctgagcgcttgctcgctcagcctcagcccgctcttc
agcatcgcctgtgccttcttcttcctcacctgcttcctgacgcgcgcgcagcgcggcccg
gaccgcggcgccggctcctggtggctgctggcgctgcctgcctgctgctacctgggcgac
ttcgcggcgtggcagtggtggtcgtggctgcgcggggagccggcggcggcggcggccggc
cggctctgcctggtgctgagctgcgtggggctgctgacgctcgcgcctcgcgtgaggctg
cggcacggagtcctggtgctgctcttcgccggcctggtgtggtgggtgtccttctccggc
ctcggggctctgccgcccgcgctcaggcctctgctgtcgtgcctggtcgggggcgcggga
tgcctgctagccctgggcttggaccacttctttcacgtccggggagcctcacctcccccg
cgctcggcgagtaccgcggatgaaaaagtgcctgtgatcagaccccggaggaggtccagc
tgcgtgtcgctgggagaaagcgcggccggttactatggcagtggcaagatgttcaggaga
ccgtcgttgccttgtatttctcgagaacagatgattctctgggactgggacttgaagcag
tggtgtaaacctcattaccagaattctggaggtggaaatggagttgatctttcagtgcta
aatgaagctcgcaatatggtgtcagaccttctgattgacccaagccttcccccacaagtc
atttcttctttgcggagtatcagtagcttgatgggtgctttctcaggttcctgtaggcca
aagattaattctttcacaccatttcctggattttatccctgttctgaagtagaagatcca
gtagagaaaggcgatcgaaaacttcacaaggggttgagtagcaaacccagtttcccgact
gcacagctgaggaggagctcaggagcgtcaggattgctgaccagtgagcaccactcacgg
tgggatcgcagcggtggcaaaaggccttaccaagaactcagtgtttcaagtcatggatgc
cacctaaatgggccttttagttcaaatcttatgacaattccaaagcagaggtcatcatct
gtgtcgctgacgcaccatgcaggtctgagaagagctggtgctttgcccagccccagtctt
ctgaattcttcaagccatgtacccgtgtctgctggctgtctaactaatcgatcacccgta
ggatttcttgataccagtgattttcttactaagccaagtgttactttacatagatcactg
ggcagtgtatccagtgcagcagatttccatcagtaccttaggaactctgacagcagtctg
tgtagcagctgtggacaccaaatactcaagtatgtttcgacatgtgaacctgatggtaca
gaccaccacaatgaaaaatcaggtgaagaagacagcactgttttctcaaaagaacgattg
aacattgtggaaactcaagaagaagagacagtgaaggaagactgcagggaattatttttg
gaaggtgatgatcacctaatggaagaggcccagcaaccgaatattgaccaggaagtgtta
ttggacccgatgttagtggaagattatgattcattaatagaaaagatgagcaactggaac
tttcagatttttgagcttgtagaaaaaatgggagaaaaatcaggaaggattctcagccag
gttatgtatactttatttcaagatactggtttattggaaacatttaaaattcccactcaa
gaatttatgaattattttcgtgcactagaaaatggctaccgagatattccatatcacaat
cgtgtgcatgccacagatgtcctacatgctgtttggtatttgacaacacgaccaattcct
ggcttacagcagctccataataaccatgaaacagaaaccaaagcagattcagatgctaga
cttagttctggacagattgcttacctttcttcgaagagttgctgtattccagataagagt
tatggctgcctgtcttcaaacattcctgcgttagaactgatggctttatatgtggcagct
gccatgcacgattatgatcacccaggaagaacaaatgcattcctagtggctacaaatgca
cctcaggcagttttatacaatgacagatctgttctagaaaatcatcatgccgcatcagcg
tggaatctgtatctttctcgcccagaatacaacttcctccttaaccttgatcacatggaa
ttcaagcgttttcgatttttagtcatagaagcaatccttgctacagatctcaaaaaacat
tttgagttccttgctgaattcaatgccaaggccaatgatgtaaatagtaacggtatagaa
tggagcagtgaaaacgatcgactcttagtctgccaggtgtgcatcaaattagcagacatc
aacggcccagcaaaagatcgggatcttcatttgagatggacagaaggcattgtgaatgag
ttttatgagcagggagatgaagaagcaaccctgggtctacctattagtcccttcatggat
cgttcttctcctcaactagcaaaactccaagagtcatttatcacccacattgtgggcccc
ctgtgcaactcctatgatgctgctggcttgctgcctggtcagtggatagaagcagaagag
ggtgacgatacagaaagtgatgatgatgatgatgatgatgatgatgatgatgatgatgat
gatgatgatgatgaagagttagattcagatgatgaagaaacagaagacaatctaaatcct
aaaccacaaagaaggaaaggcaggcggcgaatattttgccaactaatgcaccacctcact
gaaaaccacaagatctggaaggaaatcatagaagaggaagaaaaatgtaaagctgagggg
aacaaactgcaggtggataatgcctccttacctcaggcagatgagattcaggtcattgaa
gaagcagatgaagaggaagaacaaatgtttgaatga

DBGET integrated database retrieval system