KEGG   Rattus norvegicus (rat): 295180
Entry
295180            CDS       T01003                                 

Gene name
Pglyrp3b
Definition
(RefSeq) peptidoglycan recognition protein 3b
  KO
K01446  peptidoglycan recognition protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Amidase_2
Other DBs
NCBI-GeneID: 295180
NCBI-ProteinID: XP_006232903
RGD: 1304557
Ensembl: ENSRNOG00000045617
UniProt: A0A0G2QC26
Position
2q34
AA seq 339 aa
MLCRLLAFSALSLVACGSPTIVSRKVWGASSLTCRVPLSLPVPYLIIEQVTRMQCQDQTS
CSQVLRVLHSHYVHNKGWCDVAFNFLVGNDGKVYEGVGWHVQGLHTQGYNNVSLGIAFFG
SKIGSSPSPAALSATEDLIFFAILNGYLSPKYIQPFLLKEETCLVPQHSEIPKKACPNII
PRTAWEARETHCSQMNLPAKFVIIIHTAGESCNESADCLIRVRDTQSFHMDKQDFCDIAY
HFLVGQDGVVYEGVGWTIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLEAAQSLIQCAV
AMGYLASNYLLMGHSDVSNILSPGQALYNIIKTWPHFKH
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgctgtgcaggcttcttgccttctctgctctgagtcttgtggcctgtggcagtcctacc
atagtttcccgaaaagtgtggggagcaagttcactcacctgcagagtcccactgagcctg
cctgtgccctacctcatcatagagcaggttaccaggatgcaatgccaagatcagacctcg
tgcagccaggttttgcgggttctacactcccattatgtccacaacaaaggctggtgtgat
gtggctttcaacttcctggttgggaatgatggcaaggtgtatgaaggtgtcggttggcat
gtccaaggtttgcacactcaaggctacaataatgtttccctgggcattgccttctttggc
agtaagataggaagcagccccagtcctgctgctctatcagctacagaggacctgatcttc
tttgccatcctgaatggctacctgtcacccaagtacattcagccatttcttttaaaagaa
gaaacctgtttggttcctcaacactcagagatacccaaaaaagcatgccccaatatcata
ccacggactgcttgggaagccagagagacacattgctctcagatgaaccttccagccaaa
tttgtcatcatcatccacactgctggagaaagctgcaatgaatctgcagactgcttgatt
cgtgtgagagacacacagtcctttcacatggacaaacaagatttctgtgacattgcatat
cacttcctagtgggtcaagatggtgtagtatatgaaggagttggctggactattgaaggc
tctcacacctatggatacaatgatattgctcttggaattgcctttatgggaaactttgta
gaaaagcctccaaatgaagcttcactggaggcagcccagagcctgatccagtgtgctgtg
gccatggggtacctggcctccaactacctgctaatgggccacagtgatgtgtccaacatc
ctgtcccctggacaagcactatacaacatcatcaagacatggcctcacttcaagcactga

DBGET integrated database retrieval system