KEGG   Rattus norvegicus (rat): 295237Help
Entry
295237            CDS       T01003                                 

Gene name
Msto1, RGD1306110
Definition
(RefSeq) misato 1, mitochondrial distribution and morphology regulator
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Misat_Tub_SegII Tubulin_3 Tubulin
Motif
Other DBs
NCBI-GeneID: 295237
NCBI-ProteinID: NP_001099913
RGD: 1306110
Ensembl: ENSRNOG00000020357
UniProt: D3ZMW3
Position
2q34
AA seq 553 aa AA seqDB search
MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRTTEGEESPGELCPDVLYRSGRTLHGQ
ETYTPRLILMDLKGSLNTLKEEGSLYRDRQLEAAIAWQGKLTTHREEANSKNPNLQDLLS
AEGVLSSDGALRAKLIQNGKENSIKVWSDFLRVHLHPRSICVIQKYNHDGETGRLEAFGQ
GESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKTAELLQDEYSGRG
VLTWGLLPGPYSLGEPQKNIYRLLNTAFGLVHLAGYSSFVCPLSLGGNLGLRPKPPVNFP
YLHYDATLPFHCSAILATALDTVTVPYRLRSSTVSMAHLADVLSFSGKKVVTAEAIIPFP
LVRGQSLPDILMQLGEATPWTSLSACGDSAGHRCFAQSVVLRGIDRASHTSKLNPGTPLP
STLHACASGEEVLAQYLEQQHPRVLSSSYLLLTPCKMAPPYPHFFSSFSQKGLAMDGAPK
GAAVQSIPVFGALRSTSSLQRTLRDLGDELARLDLRRWASFMDAGVEQDDMEELLQELHS
LAQCYQEGGGLSN
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcggggcccgcgaggtgctcacgctgcagttgggacatttcgcgggtttcgtc
ggggcgcactggtggaaccagcaggatgctgcgttgggacgcacgaccgagggcgaagag
tcgccaggcgagctgtgcccggacgtcttgtatcgaagtggccggacactgcatggccag
gaaacctatacacctcgactcatcctcatggacctcaaaggcagtctgaataccttaaag
gaagaaggcagcctctacagggaccgacagctagaggctgcaatagcatggcaggggaag
ctcaccacacacagagaagaggccaactcaaagaacccgaacctccaggaccttctgagt
gcagagggagtgctgagtagtgatggtgccttgagggcgaaactgatccagaatggcaaa
gagaacagcatcaaagtctggtcagacttcctccgagtccatctccatccacggagcatc
tgtgtgattcagaagtacaaccatgacggtgagaccggccggctggaggcttttggccaa
ggggagagtgtcctgaaggaacccaggtacttggaagagctggaggacaggctgcatttc
tatgtggaagaatgtgattacttgcagggcttccagatcctgtgtgacctgcatgatggc
ttttctggagtaggtgctaaaactgcagaattactacaagacgagtattcagggcgcgga
gtactaacctggggtctgctgcctggtccctacagtcttggggagccccagaaaaatatc
tatcgtctcttaaacacagcatttggtctggtgcaccttgctgggtacagctctttcgtc
tgtcccttgtcccttggagggaacctgggcctgcgacccaagccacctgtcaacttccct
taccttcattatgatgccactctgcccttccactgtagcgctatcctggctacagccctg
gacacggttaccgttccctatcgcctccgctcctccacagtcagcatggctcacttggct
gatgtgctaagtttctctgggaagaaggtggtgacagcagaagccatcatccccttccca
ctggtccgaggccagtcacttcctgacattctcatgcaacttggagaagccaccccgtgg
acctccctgtctgcatgcggtgattctgccggacatcggtgctttgcccagtctgtggtg
ctcaggggcatagacagagctagccacaccagtaagctcaacccagggacacctttgccc
tccactctccatgcgtgtgcctctggagaagaagtcttggcccagtacttagagcagcag
caccctagggtcttgagttcgtcatatctgctgctgacaccctgcaaaatggctcctccg
tacccacacttcttctcaagcttcagtcagaaagggttggccatggacggggcccccaag
ggcgcagcagtgcagagcatccctgtgtttggggccttgcgttcaacttcatccttgcag
cggacactaagagacttgggtgacgagctcgccagacttgacctgcggcgctgggctagc
ttcatggacgccggggtggagcaggatgacatggaagagctgctgcaggagctacacagc
ctggcccagtgctaccaggagggcggcggcctttccaactga

DBGET integrated database retrieval system