KEGG   Rattus norvegicus (rat): 295238
Entry
295238            CDS       T01003                                 

Gene name
Dap3
Definition
(RefSeq) death associated protein 3
  KO
K17408  small subunit ribosomal protein S29
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    295238 (Dap3)
   03029 Mitochondrial biogenesis [BR:rno03029]
    295238 (Dap3)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    295238 (Dap3)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    295238 (Dap3)
SSDB
Motif
Pfam: DAP3 AAA_25 DUF3944 AAA
Other DBs
NCBI-GeneID: 295238
NCBI-ProteinID: NP_001011950
RGD: 1305339
Ensembl: ENSRNOG00000020373
UniProt: F7EZZ0 Q5U2T0
Position
2q34
AA seq 396 aa
MRTKTMLTGMTRFFSRVQKLDPRCFLHVSVQAPQNNQVPAERPRAVSRTSDSDPAKHGEQ
HEGQHYSIPPQDLKTVFPHGLPPRYAMQVKTFGEACLMVRKPALELLGYLKNTNFAHPAV
RYLLYGEKGTGKTLSLCHAVHFCAKSDWLILHIPDAHLWVKNCGELLQSTYNKQRFDQPL
EASTWLKNFKTTNERFLGQIKVQEKYVWNKRESTEKGSPLGEVVEQGLTRVRNATDAVGV
VLKELKTQSSLGLFHLLVAVDGVNALWGRTTLKREDRTLIAPEELALVRNLRKMVKNDWH
GGAIVLSLSQTGSLFKSRTAYLPHELLGKEGFNALEPFLPILISNYNPKEFESSFQYYLE
NNWLQHEKASTEEGRKELKFLSNCNPEQLERLCASL
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgagaacaaagaccatgctgacaggaatgacaaggtttttctccagggtccagaagttg
gacccgagatgttttttgcacgtgagtgtccaagcacctcagaacaatcaggttccagct
gagcgtccgagagctgtttcccgcaccagtgacagtgacccagctaagcacggggagcag
catgagggtcagcactacagcatccccccacaggatctgaagacggtgtttcctcacggc
ctgcctcctcgatacgcaatgcaggtgaagacttttggtgaagcttgtctgatggttagg
aagccagctctcgagcttctgggctacctgaaaaataccaattttgctcatccagctgta
cgatatcttctctatggagagaaggggacaggaaagaccctcagtctctgtcatgctgtt
catttctgtgcaaaaagtgactggctgattctgcacatcccagatgctcatctttgggta
aaaaactgtggggagctgctacagtccacttacaacaaacagcgctttgaccaaccctta
gaggcctctacctggctgaagaatttcaaaactaccaacgagcgctttctgggtcagata
aaagttcaagagaagtatgtttggaataagagagaaagcactgagaaaggcagtcctctg
ggagaagttgtcgaacagggcctaacgcgagtgagaaacgccactgacgctgttggggtt
gtgctgaaggagctgaagacgcagagctccctaggactctttcacctcctggtggctgtg
gatggagtcaacgccctctggggaaggaccacgctgaaaagagaagatagaaccttgatt
gccccggaggaactcgcccttgtccgcaacctaagaaaaatggtgaaaaatgactggcac
ggaggagcaattgtgctgagcttgagccaaaccgggtctctcttcaagtccagaacagcc
tatttgccacatgagctgctgggaaaggaaggatttaatgccctggagccttttcttccc
atcctcatttccaactataatccaaaggaatttgaaagttcctttcagtattacttggag
aacaactggcttcagcatgagaaagcttcaacagaggaagggaggaaggagctgaagttc
ctgagtaactgcaaccctgagcagctagagcggctctgcgcctcactgtga

DBGET integrated database retrieval system