KEGG   Rattus norvegicus (rat): 29524
Entry
29524             CDS       T01003                                 

Gene name
Limk2
Definition
(RefSeq) LIM domain kinase 2
  KO
K05744  LIM domain kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29524 (Limk2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    29524 (Limk2)
  09158 Development and regeneration
   04360 Axon guidance
    29524 (Limk2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29524 (Limk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29524 (Limk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29524 (Limk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   29524 (Limk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LIM PDZ Kdo PDZ_6 PDZ_2 APH ABC1 zf-RRN7 DUF6510
Other DBs
NCBI-GeneID: 29524
NCBI-ProteinID: NP_077049
RGD: 62056
Ensembl: ENSRNOG00000019000
UniProt: P53670
Position
14
AA seq 638 aa
MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSCFRCSECQESLTNWYYEKDGKLYC
HKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQDQLPYSVTLISMPATTECRRGFSVSVESASSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAINQTSQTLQLLIEHDPV
PQRLDQLRLDTRLSPHMQSSGHTLMLSTLDAKENQEGTLRRRSLRRSNSISKSPGPSSPK
EPLLLSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRNV
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRPPVEKAATKKRTLRKSDRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCKLEPESRPAFSKLEDS
FEALSLFLGELAIPLPAELEELDHTVSMEYGLTRDSPP
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggcggcgctggcgggtgaagaggcctggaggtgtcggggctgtggcaactatgttccc
ctgagccagaggctgtacaggacagccaacgaggcctggcatagctcctgcttccggtgt
tccgagtgccaggagtccctcaccaactggtactatgagaaggacgggaagctctactgc
cacaaggactactgggccaagtttggagaattctgccacgggtgctccctgctgatgaca
gggccagccatggtggctggggagtttaagtaccacccagagtgctttgcctgcatgagt
tgcaaggtgatcatcgaggatggggatgcgtacgccctggtgcagcatgctacactctac
tgcgggaagtgccacaatgaggtggtgctggcacccatgtttgaaagactgtctacggag
tctgtccaggaccagctgccctactctgtcacgctcatctccatgcctgccaccaccgag
tgcagacgtggcttctctgtgtctgtggaaagcgcctcctctaactatgccaccaccgtg
caagtgaaagaggtcaaccggatgcacatcagccccaacaaccgaaatgccatccacccc
ggggaccgcatcttggagatcaatgggacccctgtccgcactctccgagtagaagaggtg
gaggatgcgattaaccagacgagccagacacttcaactgctgattgaacatgaccctgtc
ccccagcgcctggaccagttacggctagacacccggctttctccccacatgcagagtagt
ggacatactctcatgctcagcaccttggacgccaaggaaaatcaggagggaacactgagg
agacgttctctgaggcgcagtaacagcatctccaagtctcctggccccagctcccccaag
gagccgctgctcctgagccgagacatcagtcgctcagagtcccttcgctgctccagcagc
tactcacagcagatcttccggccctgtgacctgatccacggggaggtcctggggaagggc
ttcttcggacaggccatcaaggtgactcacaaagccacaggcaaagtgatggtcatgaag
gagttaattcgctgtgatgaggaaacccagaagactttcctgactgaggtgaaagtgatg
cgaagcctggaccaccctaacgtgcttaagttcatcggggtcctgtacaaggacaagaag
ctgaatctgctgacagagtacattgaggggggcaccctgaaggactttctgcgcaatgtg
gacccgtttccctggcaacagaaggtcaggtttgccaaaggcatcgcttccggaatggct
tatttacactccatgtgcatcatccaccgagatctgaactcgcacaactgtctcatcaaa
ttggacaagacggtggtggtagcagacttcgggctgtcacgtctcatagtggaagagagg
aaaaggcctccagtagagaaggccgccaccaagaaacgcaccttacgcaagagtgatcgc
aagaagcgctacactgtggtgggaaacccctactggatggcccctgagatgctgaatggc
aagagctacgatgagactgtggatgtcttctcttttgggattgttctctgtgagatcatt
gggcaggtatatgctgatcccgactgccttccccgcacactggacttcggcctcaacgta
aagcttttctgggagaagtttgtcccaacagactgtcccccagccttcttccccctggct
gctatctgctgcaaactggagcctgagagcagaccggcattctcaaagctggaggactca
ttcgaggcgctctccctgttcttgggagagttggccatcccactgccagcagagctggaa
gagctggaccacactgtgagcatggagtatggcctaacccgggactcgccaccctag

KEGG   Rattus norvegicus (rat): 65172
Entry
65172             CDS       T01003                                 

Gene name
Limk1
Definition
(RefSeq) LIM domain kinase 1
  KO
K05743  LIM domain kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    65172 (Limk1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    65172 (Limk1)
  09158 Development and regeneration
   04360 Axon guidance
    65172 (Limk1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    65172 (Limk1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    65172 (Limk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    65172 (Limk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     65172 (Limk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   65172 (Limk1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LIM PDZ Kdo APH PDZ_6 ABC1 Pkinase_fungal Haspin_kinase RIO1 PDZ_2 TCAD9 PknG_TPR
Other DBs
NCBI-GeneID: 65172
NCBI-ProteinID: NP_113915
RGD: 62055
Ensembl: ENSRNOG00000001470
UniProt: G3V663
Position
12
AA seq 647 aa
MRLTLLCCTWREERMGEEGSELPVCASCSQSIYDGQYLQALNADWHADCFRCCECSTSLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICLACGNFIGD
GDTYTLVEHSKLYCGQCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHIGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDSLGHGPVSDPSPLASPVHTPSGQAGSSARQKPVLRSCSID
TSPGAGSLVSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFG
LARLMIDEKGQSEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EQWLETLRMHLAGHLPLGPQLEQLERGFWETYRRGESSLPAHPEVPD
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgaggttgacgctactttgttgcacctggagggaagaacgtatgggagaggaaggaagc
gagttgcctgtgtgtgcgagctgtagccagagtatctatgacggccagtacctccaggcc
ctgaatgctgactggcatgcggattgcttcaggtgctgcgagtgtagcacctccctttca
caccagtactacgagaaggatggacagctcttctgcaagaaggactactgggcccgctat
ggcgagtcttgccacgggtgctccgaacacatcaccaaagggctggtcatggtggccggg
gagctgaagtatcaccccgagtgcttcatctgccttgcctgtggaaacttcatcggtgat
ggggacacctacacactggtggagcactccaagctgtactgcgggcagtgctactaccag
actgtggtaactccagtcatcgaacagatcctccctgactcacccggctcccacctgccc
cacacagtcaccctcgtgtctatcccagcctctgctcatggcaaacgaggcctgtctgtc
tccatcgacccccctcacggcccaccaggatgtggcacggagcattcgcacacggtccga
gtccaaggagtggacccgggctgcatgagcccggatgtgaagaattccatccacatcgga
gacaggatcttggaaatcaacggcacgcccatccggaatgtgccgctggacgagatcgac
ttgctgatccaggagaccagccgcctgctccagctgaccctcgagcacgacccccatgac
tcactgggccatgggccagtgtcggatcccagccccctggcctccccggtacacactccc
agcggacaggcaggcagctctgcccggcagaaacctgtcttgaggagctgcagtattgac
acgtccccgggtgccggctcactagtctcaccagcctcccagcgcaaggacctgggtcgc
tccgaatccctccgagtggtttgtcgaccacaccgcatcttccggccgtctgacctcatc
catggggaggtgttgggcaagggctgtttcggccaggccatcaaggtgacacatcgagaa
acgggcgaggtgatggtgatgaaggaactcatccggtttgacgaggagacccagaggaca
ttcctcaaggaggtgaaggtcatgcgatgcctggagcaccctaacgtgctcaagttcatc
ggcgtgctgtacaaggacaagcggctgaacttcatcaccgagtacatcaagggcggcacc
ctgcggggcatcatcaagagcatggacagccagtacccgtggagtcagagggtcagcttt
gccaaggacattgcatcagggatggcctacctccattcgatgaacatcatccaccgagac
ctcaactcccacaactgtctggtccgtgagaacaggaacgtggtggtggctgactttggg
ctggctcgactcatgatcgatgagaagggtcagtctgaagacttgcgtagccttaagaag
ccggaccgcaagaaacggtacacagtggtgggtaacccctactggatggcgccagagatg
atcaatggtcgtagttacgatgaaaaggtggacgtgttttcctttggaattgtcctttgt
gagattatcgggcgtgtgaatgcagaccctgactatctgccccgcactatggactttggc
ctcaatgtaaggggtttcctggaccgctactgtccaccaaactgtcccccaagtttcttc
cccatcactgtgcgctgctgtgacctggatcctgagaagaggccctcttttgtaaagctg
gaacaatggctagaaacacttcgcatgcacttggctggtcacctgccactgggcccacaa
ctggaacaactggagcggggcttctgggagacctaccggcggggcgagagctcgctaccc
gcccaccccgaggtccctgactga

DBGET integrated database retrieval system