KEGG   Rattus norvegicus (rat): 295264
Entry
295264            CDS       T01003                                 

Gene name
Mllt11, RGD1305525
Definition
(RefSeq) myeloid/lymphoid or mixed-lineage leukemia; translocated to, 11
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: WRNPLPNID
Other DBs
NCBI-GeneID: 295264
NCBI-ProteinID: NP_001013934
RGD: 1305525
Ensembl: ENSRNOG00000021110
UniProt: Q5M971
Position
2q34
AA seq 90 aa
MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDSPTYKSKESNSIGKMGGQATGAERKS
PEGDPLLEYSTFNFWRAPIASIRSIDLDLL
NT seq 273 nt   +upstreamnt  +downstreamnt
atgcgggaccctgtgagtagccagtacagctcctttcttttctggaggatgcccatccca
gaactggatctgtcggagctggaaggcctgggcctgtcagattcacctacctacaagagc
aaggagagcaacagcattggcaaaatgggtgggcaggcaaccggagctgagcggaagagc
cctgaaggcgaccccctccttgagtatagcaccttcaacttctggagagcccctattgcc
agcatccgctcgatcgacctggacttgctctaa

DBGET integrated database retrieval system