KEGG   Rattus norvegicus (rat): 295270
Entry
295270            CDS       T01003                                 

Gene name
Sf3b4
Definition
(RefSeq) splicing factor 3b, subunit 4
  KO
K12831  splicing factor 3B subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    295270 (Sf3b4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    295270 (Sf3b4)
Spliceosome [BR:rno03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    295270 (Sf3b4)
 Complex B
    295270 (Sf3b4)
 Complex C
   U2 SnRNP specific factors
    295270 (Sf3b4)
SSDB
Motif
Pfam: RRM_1 RRM_7 RRM_5 OB_RNB
Other DBs
NCBI-GeneID: 295270
NCBI-ProteinID: NP_001011951
RGD: 1309667
Ensembl: ENSRNOG00000021181
UniProt: Q6AYL5
Position
2q34
AA seq 424 aa
MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE
FLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTF
SAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKK
DSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPP
GSFPPPVPPPGALPPGIPPAMPPPPMPPGAGGHGPPAAGTPGAGHPGHGHSHPHPFPPGG
MPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGS
PMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRG
PLPQ
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggctgccggaccgatctccgaacggaatcaggatgccacggtgtacgtgggaggtcta
gacgagaaagtgagcgagccactgctatgggagctctttctccaggcagggccagtggtc
aacacccacatgccaaaggatagagtcactggccagcaccaaggctatggctttgttgaa
ttcttgagtgaggaagatgctgactatgccattaagattatgaacatgatcaaactctat
gggaagccaatacgggtgaacaaagcctcggctcacaacaaaaacctggatgtaggagcc
aacattttcattggaaatctggacccagaaattgatgagaagttgctttacgatactttt
agcgcctttggagtcatcttacagacccccaagattatgcgggaccctgacacaggcaac
tccaagggttacgccttcattaattttgcttcatttgatgcttcagatgcagcaattgag
gccatgaatgggcagtacctgtgtaaccgccctatcactgtgtcttatgccttcaagaag
gactctaagggtgaacgacatggctcagcagctgaacgacttctggcagcccagaacccg
ctgtctcaggctgaccgccctcatcagctgtttgccgatgcaccccctccaccctctgcc
cccaatcctgtggtttcatccctgggttctgggcttcctccaccaggaatgccacctcct
ggttcgttcccacctccagtgccacctcctggggcccttcctcctgggatacccccagca
atgcccccaccacctatgccacctggggctggaggacatggtcccccagcagcaggaact
ccaggggctggacatcctggtcatggacattcacatcctcatccattcccaccaggtggg
atgccccatccagggatgtcccagatgcagctggcccaccatggcccccatggcctagga
cacccccatgctgggcctccaggctctggagggcagccaccaccccgaccaccccctgga
atgcctcatcctggaccacctccgatgggcatgcctccccgagggcctccttttggatct
cccatgggtcacccaggtcccatgcctccacacggtatgcgtgggcctcctccattgatg
ccccctcatggatacaccggtcctccgagaccccctccctatggctaccagcggggaccc
ctccctccacccagacccactccacggcccccagttcctcctcgtggtccacttcggggc
ccacttcctcagtaa

DBGET integrated database retrieval system