KEGG   Rattus norvegicus (rat): 295274
Entry
295274            CDS       T01003                                 

Gene name
Hist2h2be, RGD1562346
Definition
(RefSeq) histone cluster 2, H2be
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    295274 (Hist2h2be)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    295274 (Hist2h2be)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    295274 (Hist2h2be)
  09165 Substance dependence
   05034 Alcoholism
    295274 (Hist2h2be)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    295274 (Hist2h2be)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    295274 (Hist2h2be)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    295274 (Hist2h2be)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   295274 (Hist2h2be)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF3915
Other DBs
NCBI-GeneID: 295274
NCBI-ProteinID: XP_001061909
RGD: 1562346
Ensembl: ENSRNOG00000045753
UniProt: D4A817
Position
2q34
AA seq 126 aa
MPELAKSAPAPKKGSKKAVTKGQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIANEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaactggccaaatccgctccggctcccaagaagggctcaaagaaggctgtcacc
aaggggcaaaagaaagacggcaagaagcgcaagcgcagtcgcaaggagagctactccatc
tatgtgtacaaggtgctgaagcaggtgcatccggacacgggcatctcgtccaaggccatg
ggcatcatgaactcgtttgtcaatgacatcttcgagcgcatcgcaaacgaggcttctcgc
ctggcgcattacaacaagcggtctacaatcacatcgcgggagatccagacggcggtgcgt
ctcctactgcccggagaactggctaagcacgctgtgtcggagggcaccaaggcggtcacc
aagtacacaagcgccaagtag

DBGET integrated database retrieval system