KEGG   Rattus norvegicus (rat): 295277
Entry
295277            CDS       T01003                                 

Gene name
Hist2h4, Hist4h4
Definition
(RefSeq) histone cluster 2, H4
  KO
K11254  histone H4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    295277 (Hist2h4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    295277 (Hist2h4)
  09165 Substance dependence
   05034 Alcoholism
    295277 (Hist2h4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    295277 (Hist2h4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    295277 (Hist2h4)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 295277
NCBI-ProteinID: NP_001116941
RGD: 1307448
Ensembl: ENSRNOG00000032224
UniProt: P62804
Position
2q34
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggcagaggaaagggtggtaagggcttaggcaagggtggcgccaagcgtcaccgc
aaggtcttgcgggataacatccaggggatcaccaagcccgccatccgtcgcctagctcgg
cgtggcggtgtcaagcgcatctccggcctcatctatgaggagacccgtggtgtactgaag
gtgttcctggagaacgtgatccgcgacgcagtcacctacactgagcacgccaagcgcaag
accgtcaccgccatggatgtggtgtacgctctcaagcgccagggccgaaccctgtacggc
ttcggaggctag

DBGET integrated database retrieval system