KEGG   Rattus norvegicus (rat): 295279
Entry
295279            CDS       T01003                                 

Gene name
Fcgr1a
Definition
(RefSeq) high affinity immunoglobulin gamma Fc receptor I precursor
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04613  Neutrophil extracellular trap formation
rno04640  Hematopoietic cell lineage
rno04666  Fc gamma R-mediated phagocytosis
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    295279 (Fcgr1a)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    295279 (Fcgr1a)
   04613 Neutrophil extracellular trap formation
    295279 (Fcgr1a)
   04666 Fc gamma R-mediated phagocytosis
    295279 (Fcgr1a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    295279 (Fcgr1a)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    295279 (Fcgr1a)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    295279 (Fcgr1a)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    295279 (Fcgr1a)
   05152 Tuberculosis
    295279 (Fcgr1a)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    295279 (Fcgr1a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    295279 (Fcgr1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    295279 (Fcgr1a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    295279 (Fcgr1a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    295279 (Fcgr1a)
CD molecules [BR:rno04090]
 Proteins
  295279 (Fcgr1a)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4 I-set
Other DBs
NCBI-GeneID: 295279
NCBI-ProteinID: NP_001094306
RGD: 1309912
Ensembl: ENSRNOG00000021199
UniProt: A0A0B4J2J0
Position
2
AA seq 353 aa
MWLLTTLLLWVPVGGQVVNATKAVVTLQPPWLSIFQEENVTLLCEGPHLGDSSTKWFINS
TAIQISTPTYSILKASFKDSGEYKCQTGLSMPSDPVQLEIYRDWLLLQTSHRVLTEGEPL
ALRCHPWQNKKVYNVAFYRNGESLDFSQGSEVTILKTNLSHSGIYHCSAMGKKLFKSAGV
SVTVKELFATPVLRVSLSSPFPEGSLVILNCETRLFLQSPGLRLYFSFYVGSKILEDRST
SSEYHIPRAEREDDGSYWCEVATEDGRVLKRSTKLELFGPQSSDPVWFHILFYLSVGIMF
LVNTVLYVKIHRLQREKKYNLEVPLVSEKGKKATSFQQVRSDDVYEEVTATVR
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtggcttctaacgactctgctactttgggttccagttggtgggcaagtagttaatgcc
acaaaggctgtggtcaccttgcagcccccatggctcagcattttccaggaggaaaatgtc
actttgttgtgtgagggacctcacctgggagacagttccacaaagtggtttatcaacagc
acagccattcagatctccacacctacctatagcatcctcaaggccagtttcaaggacagt
ggtgaatacaagtgtcagacaggtctctcaatgccaagtgaccctgtgcagttagaaatc
tacagagattggctgctactccagacctcccacagagtcctcacagaaggagagcctctg
gccttgaggtgtcacccgtggcagaataagaaagtgtacaatgtggctttctatcgaaat
ggagaatcccttgacttttctcaaggttcagaggtcaccattctgaaaaccaacctgagt
cacagcggcatctatcactgctcagccatgggaaaaaaactcttcaagtctgcaggagtg
tctgtcaccgtgaaagagctatttgccacaccagtgctgagagtgtccttgtcatctccc
ttcccggaggggagtctggtcatcctgaactgtgagacaagattgttcctgcagagtcct
ggcttacggctttacttctccttctatgtgggcagtaagatcctggaggacaggagcaca
tcctccgagtaccacataccaagggctgaaagggaagatgatggatcatactggtgcgag
gtagccacggaggacggccgtgtccttaagcgcagcaccaagttggagctatttggtccc
cagtcatcagatcctgtctggtttcacatcctattttatctgtcagtgggaataatgttt
ttggtgaacacagttctctatgtgaaaatacacaggctgcagagagagaaaaaatacaat
ttagaagtccctttggtttctgagaaggggaagaaagcaacttcctttcagcaagttaga
agcgatgacgtgtatgaagaagtaacagccactgtaagatag

DBGET integrated database retrieval system