KEGG   Rattus norvegicus (rat): 29528Help
Entry
29528             CDS       T01003                                 

Gene name
Vamp3
Definition
(RefSeq) vesicle-associated membrane protein 3
  KO
K13505  vesicle-associated membrane protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    29528 (Vamp3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29528 (Vamp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29528 (Vamp3)
Membrane trafficking [BR:rno04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    29528 (Vamp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin Env-gp36 MCU LMBR1 RIFIN DUF2207
Motif
Other DBs
NCBI-GeneID: 29528
NCBI-ProteinID: NP_476438
RGD: 61880
Ensembl: ENSRNOG00000030055
Vega: OTTRNOG00000002318
UniProt: P63025
Structure
PDB: 

Position
5q36
AA seq 103 aa AA seqDB search
MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAG
ASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaggggtgccttcagggtccagtgctgccactggcagtaatcgaagactccag
cagacacagaatcaagtagatgaggtggtggacatcatgagagtcaatgtggataaggtg
ttagaaagagaccagaagctctcagagctagacgaccgcgcagatgcactgcaggcaggc
gcctcgcagtttgaaacaagtgctgccaagttgaagagaaagtattggtggaagaactgc
aagatgtgggcgatagggatcagtgtcctggtgattattgtcattatcatcattgtgtgg
tgtgtctcttaa

DBGET integrated database retrieval system