KEGG   Rattus norvegicus (rat): 295284
Entry
295284            CDS       T01003                                 

Gene name
Rbm8a
Definition
(RefSeq) RNA-binding protein 8A
  KO
K12876  RNA-binding protein 8A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    295284 (Rbm8a)
  09122 Translation
   03013 RNA transport
    295284 (Rbm8a)
   03015 mRNA surveillance pathway
    295284 (Rbm8a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    295284 (Rbm8a)
   03041 Spliceosome [BR:rno03041]
    295284 (Rbm8a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     295284 (Rbm8a)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   EJC/TREX
    295284 (Rbm8a)
SSDB
Motif
Pfam: RRM_1 RRM_3 RRM_5
Other DBs
NCBI-GeneID: 295284
NCBI-ProteinID: NP_001258067
RGD: 1310099
Ensembl: ENSRNOG00000021215
UniProt: Q27W01
Position
2
AA seq 174 aa
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD
GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE
YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
NT seq 525 nt   +upstreamnt  +downstreamnt
atggcggacgtgctggatcttcacgaggccgggggcgaggatttcgccatggatgaggat
ggtgacgaaagcatccacaaactaaaagaaaaagcgaagaaacggaagggccgcggtttt
ggttctgaagaggggtcccgagcgcggatgcgggaagattatgacagtgtggagcaggat
ggcgatgaacctggaccacagcgctctgttgaaggttggattctctttgtcactggagtc
cacgaagaagccactgaagaagatatccatgacaagttcgctgaatatggggaaataaaa
aatatccacctgaatttggacaggcgcacgggatacttgaaggggtatactctagttgag
tatgaaacatacaaagaagctcaggctgccatggagggactaaatggtcaagatttgatg
ggacagccaatcagtgttgactggtgttttgttcgtggtccaccaaagggcaagaggaga
ggtggccgaagacgaagcaggagtccagaccgaagacgccgatga

DBGET integrated database retrieval system