KEGG   Rattus norvegicus (rat): 29530Help
Entry
29530             CDS       T01003                                 

Gene name
Amhr2
Definition
(RefSeq) anti-Mullerian hormone receptor type 2
  KO
K04672  anti-mullerian hormone receptor type-2 [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    29530 (Amhr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29530 (Amhr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29530 (Amhr2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     29530 (Amhr2)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   29530 (Amhr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 29530
NCBI-ProteinID: NP_112260
RGD: 70964
Ensembl: ENSRNOG00000014850
UniProt: Q62893
Position
7q36
AA seq 557 aa AA seqDB search
MLGTLGLWTLLPAAAQVSPNRRTCVFFEAPGVRGSTKTLGEVVDAGPGPPKGIRCLYSHC
CFGIWNLTHGRAQVEMQGCLDSDEPGCESLHCDPVPRAHPSPSSTLFTCSCGTDFCNANY
SHLPPSGNRGAPGPQEPQATPGGPIWMAQLLLGVFLVLLLSIIILALLQRKACRVQGGSD
PEPEPGSGGDCSEELPELAELRFSQVIQEGGHAVVWAGRLQGEMVAIKAFPPRAVAQFRA
ERAVYQLLGLQHNHIVRFITAGQGGPGPLPSGPLLVLELYPKGSLCHYLTQYTSDWGSSL
RMALSLAEGLAFLHGERWQDGQYKPGIAHRDLSSQNVLIREDRSCAIGDLGLALVLPGLA
QPPALAPTQPRGPAAILEAGTQRYMAPELLDKTLDLQDWGTALQRADVYSLALLLWEILS
RCSDLRPDHRPPPFQLAYEAELGSNPSACELWALAVAERKRPNIPSSWSCSATDPRGLRE
LLEDCWDADPEARLTAECVQQRLAALAYPQVASSFPESCPQGCPENCPAAPASAAFPCRP
QQSSCLLSVQQGSGSKS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgctggggacactggggctttggacactgcttcctgcagctgcacaagtatccccaaac
aggaggacctgtgtgttctttgaggctcctggagttcggggaagcacaaaaacactgggg
gaagtggtagatgcaggaccaggccccccgaagggtatccgctgcctctacagccattgc
tgctttgggatctggaatctgacccatggccgggcacaagtggagatgcaaggatgccta
gacagtgatgaacccggctgtgagtccctccactgtgaccccgtcccccgagcgcacccc
agccccagctccacactcttcacatgctcctgcggtaccgacttctgcaatgccaactac
agccatctgcctccttcaggaaaccgaggggctcccggcccccaggagcctcaggctacc
ccaggtgggcccatctggatggcgcagctgctgctgggagtgttccttgtgctgctgctg
agtatcatcatcttggccctgttacaacgaaaagcctgtagagtgcaaggtgggtcagac
ccggagccggagccaggctcaggaggagactgcagtgaggaactgcccgagttggctgag
ctgcgcttctcccaggtaatccaggaaggaggtcatgcagtcgtctgggctgggaggctc
cagggtgagatggtagccatcaaggccttccccccaagggctgtggcccagttccgagct
gagcgagctgtgtaccagctgctaggcctacagcataaccacattgttcgctttatcact
gctggccagggaggtcctggccccttgccctctgggcctttgctggtactggaactgtac
cctaagggctccttatgccactacttgactcagtacacgagcgactggggcagttccttg
aggatggctctgtccctggccgagggcctggcgtttctccacggggagcgttggcaggat
ggccagtacaaaccaggtatcgctcaccgagacctgagcagccagaatgtgctcattcgg
gaagataggtcatgtgccatcggagacctgggccttgccttggtactccctggccttgct
cagccccctgccttggcccctactcaaccccgaggcccagctgccattttggaggctggc
acccagaggtacatggctccggagctcttggacaagactctagacctgcaggactggggc
acagctctccagagagcggatgtttactctctggctctactactgtgggagatcctgagc
cgctgttccgatttgaggcctgaccacagaccaccaccttttcaattggcttatgaggca
gaactgggcagcaatcccagtgcctgtgagctctgggccctggcggtcgcggagaggaag
cgccccaacatcccttcctcttggagctgctctgccacagaccctagggggctgagggag
ctcctggaagattgctgggacgcagacccagaagcaaggctgacagctgagtgtgtgcag
cagcgcctggcagccctggcttatcctcaggtggcttcctccttcccagagagctgtcca
cagggctgcccagagaactgccctgcagcgcctgcctctgcggctttcccctgcaggcct
cagcagagttcttgtctcctcagtgttcagcaaggctctggctctaagtcctga

DBGET integrated database retrieval system