KEGG   Rattus norvegicus (rat): 295310Help
Entry
295310            CDS       T01003                                 

Gene name
Zfp697, RGD1308711, Znf697
Definition
(RefSeq) zinc finger protein 697
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 Zn-ribbon_8 zf_UBZ zf-C2H2_jaz DZR ADK_lid Yippee-Mis18 zinc_ribbon_15 DUF2039 DUF3268 zf-C2H2_6 DUF2256 C1_4
Motif
Other DBs
NCBI-GeneID: 295310
NCBI-ProteinID: NP_001258263
RGD: 1308711
Ensembl: ENSRNOG00000048181
UniProt: D4AA20
Position
2q34
AA seq 564 aa AA seqDB search
MEQEDNLGVCADQSSEDRGMGSDFENSEDQEGDPEERGVGSNPQDTEERGHLEQELDSNP
QDDDLRGDPPERDIVSTVCSEGLLSEEEGAILREEEDDQPGVADMALFPGLSESDSITRS
PQGEEEEEEEEEEESAGENRLIEKEEPLPTPVLPWRRHLSLGGRHRGDKPAYRRFHRLHH
PMAVDLGELDSLMASIMDAPTICPDCGESFSPGAAFLQHQRIHRLAEAAAMASLEPFGLA
GECGGVVGMMGVGMGVSGGFGAGPTLARPPREKPFRCGECGKGFSRNTYLTNHLRLHTGE
RPNLCADCGKSFSWRADLLKHRRLHTGEKPYPCPECGEAFSLSSHLLSHRRAHAAAGGAG
SAAAAAAALRPFACGECGKGFVRRSHLANHQRIHTGEKPHGCGECGKRFSWRSDLVKHQR
VHTGEKPYMCSECGETFSVSSHLFTHKRTHSGERPYVCRECGKGFGRNSHLVNHLRVHTG
EKPFSCGQCEKRFSDFSTLTQHQRTHTGEKPYTCLECGKSFIQSSHLIRHRRIHTGNKPH
KCTGCGKGFRYKTHLAQHQKLHLC
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggaagataatctgggggtgtgtgcagaccagtcttctgaagacagaggcatg
ggttcagactttgagaactccgaggaccaagaaggagacccagaagaaagaggagtgggc
tctaatccacaggacacagaagagagaggccacctggagcaggagttggattccaaccca
caggatgatgacctaagaggggacccaccagagagggacatagtgtccactgtctgttca
gaggggctgctgagtgaggaagaaggggctatcctccgtgaggaagaggacgaccagcct
ggtgtggctgacatggcgctgttcccaggactgtcagaatctgatagcataacccggagt
ccccagggagaggaagaggaggaggaagaggaagaggaggaaagcgctggggagaaccgc
ttgatagagaaggaagagcctttgcctactccggtgcttccctggaggcgtcacctctcc
ctgggcggtcgacaccggggtgacaagcctgcttatcgccgcttccaccggctccatcac
cccatggccgtggacctcggggaactcgacagcctcatggccagcatcatggacgcgccc
accatctgtccggactgcggggagagctttagcccaggtgccgcattcctacagcaccag
cgcatccaccgcctggcggaggccgcggccatggccagcctggagcccttcggtttggct
ggggagtgcggaggagtggtggggatgatgggcgtgggcatgggcgtgtccggcggcttc
ggggcggggccgacgttggcccggccccctcgcgagaagcccttccgctgcggcgagtgc
ggcaaaggcttcagccgcaacacttacctgaccaaccacctgcggctgcacacgggcgag
cggcccaacttgtgcgccgactgcggcaagagcttcagctggcgcgccgacctgctcaag
caccggcgcctgcacacgggcgagaagccctacccgtgcccggagtgcggcgaagccttc
agcctcagttcgcacttgctcagccaccggcgcgcgcacgcggcggcgggcggcgcgggc
tctgcggcggcggcggcggcggcgctgcggcccttcgcgtgcggggagtgcggcaagggt
ttcgtgcgccgctcgcacctagccaaccaccagcgcatccacaccggcgagaagccgcac
ggctgcggcgagtgcggcaagcgcttcagctggcgctcggacctggtgaagcaccaacgc
gtgcacacgggcgagaagccctacatgtgctccgagtgcggcgagaccttcagcgtgagc
tcgcacctcttcacgcacaagcgcacgcactcgggcgagcggccctacgtgtgccgggag
tgtggcaagggcttcggccgcaactcgcacctggttaaccacttgcgcgtgcacaccggg
gagaagcccttcagctgcggccagtgcgagaagcgcttcagcgacttctccacgctcacg
cagcaccagcgcacgcacacgggcgagaagccctacacgtgcctcgagtgcggcaagagc
ttcatccagagctcccacctcatccgccaccggcgcatccacaccggcaacaagcctcac
aagtgcacgggctgcggcaagggcttccgctacaagacgcaccttgcgcagcaccagaag
ttgcacttatgctag

DBGET integrated database retrieval system