KEGG   Rattus norvegicus (rat): 295333
Entry
295333            CDS       T01003                                 

Gene name
Dennd2c, RGD1308197
Definition
(RefSeq) DENN domain containing 2C
  KO
K20161  DENN domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    295333 (Dennd2c)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    295333 (Dennd2c)
SSDB
Motif
Pfam: DENN uDENN dDENN
Other DBs
NCBI-GeneID: 295333
NCBI-ProteinID: NP_001178498
RGD: 1308197
Ensembl: ENSRNOG00000018716
UniProt: D3ZX30
Position
2q34
AA seq 923 aa
MHPTGTMDVGFTRSAVQTLSRSHCKNIKQKISQWEGRANGVTQPAKFHPKDFGVRYNNCH
QERPPHKHPTGEERNGGLPRNTDARSHDQSEGESESRELKDPHPLEGEPNSSRMCARVKQ
IESCQAVAVDPEASLPPGNFYTSQIPWKSIEGLTPNKVFTVALSPCDFTEEEPELSVLDS
SYRVAKSLENIYCEPEGQECGPSINPLPKPRRTFRYLSESDGMPYKERNCDQKNCESVCC
ADSSLASFQDPEPKRYGGKIRGRSKRKSFEFEDIQHFRNSRKIHEELERNAGSALYYTQS
EDNIYEDIIYPAKENPYEDIPVQSFPIWRSPSAWRLPPAKSAFRTPKLPPKPQFLQRKTM
ELKNTQAYLRSKLTKDTTLPVTLTEWKLFRAGEVANRKKRNLPRLVLKINDTFESKRGKK
RVKLQPYTGKEAPSSKGETSGNESDAEYLPKNRHKRLAQLQQSSKRSPHYQTLERDLIEL
QEQQLFELFVVVSLQKKASGMEYMPRVIQQFPSKGDHGYKQSKDTEERLKVIPRFCFPDS
EDCAPTLELKSETFSFVLTGEDGSRWFGYCKKLLPEGRGKRLPEVYCMVSRLGCFNLFSK
ILDEVEKRREMSPALVYPFMRSVMEAPFPAPGRTITVKSYLPGAGDESIELCRPLDSRLE
HVDFECLFKCLSVRHLIRVCASLLLERRVIFVADSLSTLSKCGHAVVATLYPFTWQHTYI
PVLPVSMIDIVCSPTPFFIGILSCSLPLLQDLPIEEVLIVDLCADKFLQEVSDEDEIMPP
KLQAALVQILEERDEVLAQERQFSQDVTLNSLVSEAFVRFFVELVGHYSLNMTVTERGER
VFLREPFRKSHTSRSVRHFLDLFMETQMFAGFVQDRELRQSGVKGLFEVRALQYLETIPE
SEPSGVNRILRSLGSKMRFLHKK
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgcaccccactgggaccatggatgtgggctttacgcggtctgctgttcagaccctgtcc
aggagccactgcaaaaacatcaagcaaaagatctcccagtgggaaggaagagccaatggt
gtaactcagccagccaagtttcacccaaaggattttggtgtgagatataataactgccac
caggagcgtcctcctcataagcatcccaccggtgaggaaaggaatgggggtttacccaga
aacacggacgccagaagccacgatcaaagtgagggtgaaagcgagagtcgagagcttaaa
gacccccaccccttggaaggtgaaccaaactccagccgcatgtgtgcccgggtcaaacaa
atcgaaagctgccaagctgttgctgtggatccagaggcttcgctacctccaggaaacttc
tatacctcgcagataccgtggaagagcatagaagggcttaccccgaacaaagtcttcact
gtggccttatcaccttgtgactttacagaagaggaaccggagctcagtgttctggatagt
tcttacagagtagccaagagcttggaaaatatttattgtgaacctgaggggcaggaatgt
ggcccctctataaatcctttgcccaaaccccgtaggacattcaggtatttatctgaatct
gatggcatgccatataaagaaaggaactgtgaccaaaagaactgtgagagtgtttgctgt
gcagactcttcgttggcctcttttcaggatcccgagccgaagagatatggtgggaagatc
agagggaggtccaaaaggaaatcttttgaatttgaagatattcagcactttcggaactca
cggaagattcatgaagaacttgagagaaatgctggctcagcactttattacacacagtcg
gaggataatatctatgaggatattatatacccagccaaggaaaatccctatgaagatatc
ccagtgcagtcattccccatttggagatccccttcagcatggaggctgccacctgctaag
agtgccttccgaacacccaagcttcctcccaaaccccagttccttcagcggaagactatg
gaactgaagaacactcaggcgtatttgcgatcaaaactcacgaaggataccactttacct
gtcaccttaacggaatggaaacttttccgagctggagaagtggctaacaggaaaaagaga
aatctccctcggcttgttttgaaaatcaatgatacgtttgaatctaagagagggaagaag
agggtaaagttacagccttacaccggaaaagaagccccctcctcaaaaggtgaaaccagt
gggaacgagagcgatgctgagtacctgccaaagaaccgccacaagcgcttggcacagctg
cagcagtcctccaagaggagcccccactaccagaccttggagcgggatctgatcgaactg
caggaacagcagctttttgaactcttcgtggtggtttctcttcagaagaaggcatcaggg
atggagtacatgccccgggtcatacagcagttccctagcaagggtgaccatggctacaag
cagtccaaagacactgaggagaggctcaaagtcatccccagattttgttttcctgattct
gaggactgtgcaccaaccttagaactcaagagtgaaacgttctccttcgtgctgactggg
gaagatggaagtcggtggtttggctactgtaagaagcttttgccagaaggcagagggaag
cggctccccgaggtgtactgcatggttagtcgcttgggctgcttcaatcttttctcaaag
attctggatgaagtagagaagagaagagaaatgtccccagcccttgtttacccattcatg
cgaagtgtcatggaagcccctttcccagctcctggccgcaccatcacagttaagagctac
ctccctggggctggagatgagtcaattgaactctgccgaccactggactcacgactggaa
catgtggattttgaatgtctttttaagtgcttgagtgtgcgccatctcatccgggtctgt
gcctccctgcttctcgagcggagggtaatctttgttgccgacagcctaagcaccctttca
aaatgtggccatgccgtggtggctacactgtatccgttcacctggcagcacacctacatc
ccagtgttgccagtgtccatgattgacatcgtgtgctcacctactccattctttattggg
atcttgtcttgttccttacccctactccaggatcttcccattgaagaggtgctgatagtc
gatctctgtgcagacaagttcctacaggaggtgtctgacgaggatgagatcatgccacct
aaactccaagctgccttggtgcagattttagaagagcgagatgaagtcttggcccaggag
cggcagttttcgcaagatgtgactctcaattctctggtgtcagaagcatttgtcaggttt
tttgtggaactcgtggggcattattctctgaatatgactgtcacggagcgtggggagcgt
gtgttcctaagggagccattccggaagtcccacacctcccgaagtgtccgccacttccta
gatctcttcatggagacacagatgtttgcaggattcgtccaggaccgggagcttcggcaa
agtggagttaaaggtttgtttgaagtccgggctcttcaatatttagaaacaattcctgag
tcggaacccagcggggtgaatagaattttacggagtcttggaagcaaaatgagatttctt
cacaagaagtga

DBGET integrated database retrieval system