KEGG   Rattus norvegicus (rat): 295334
Entry
295334            CDS       T01003                                 

Gene name
Bcas2
Definition
(RefSeq) pre-mRNA-splicing factor SPF27
  KO
K12861  pre-mRNA-splicing factor SPF27
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    295334 (Bcas2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    295334 (Bcas2)
   03400 DNA repair and recombination proteins [BR:rno03400]
    295334 (Bcas2)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    295334 (Bcas2)
 Complex C
   Prp19-CDC5 complex
    295334 (Bcas2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    295334 (Bcas2)
SSDB
Motif
Pfam: BCAS2 HAUS2 DUF4201 THOC7 Tup_N CENP-F_leu_zip DUF3450
Other DBs
NCBI-GeneID: 295334
NCBI-ProteinID: NP_001099928
RGD: 1306485
Ensembl: ENSRNOG00000018783
UniProt: B5DFM8
Position
2
AA seq 225 aa
MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSA
FETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQDCVNNSMAQLEHQAVR
IENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGAKLRE
MESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcgggcacgggcttggtagcgggggaggtggtagtggatgcgctaccctactttgac
caaggctatgaagcgcctggcgtgcgggaagcggctgcggccctggtggaggaggaaacg
cgcagataccgacctaccaagaactacctgagctacctgacagccccagattattctgcc
tttgaaacagacataatgagaaatgagtttgaaagactggctgctcgacaaccaattgaa
ttactcagcatgaagcgatatgaactgccagccccttcctcgggtcaaaaaaatgacatc
actgcgtggcaagactgtgtaaacaattctatggcccagctggagcatcaggcagtgcgg
attgagaatctggaactgatgtcacagcatgggtgtaacgcctggaaagtgtacaacgaa
aaccttgttcacatgattgaacatgcacagaaagagcttcagaagttaaggaagcatatt
caggatttaaactggcagcgcaagaacatgcagcttacagctggggctaagctgagagaa
atggagtcaaattgggtgtcgctggtgagtaagaactatgagattgagcggactattgta
cagttggagaacgagatctatcaaatcaagcagcagcacggtgaggcaaacaaggaaaac
atccgccaagacttctga

DBGET integrated database retrieval system