KEGG   Rattus norvegicus (rat): 295338
Entry
295338            CDS       T01003                                 

Gene name
Ptpn22, Ptpn8
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 22
  KO
K18024  tyrosine-protein phosphatase non-receptor type 12/18/22 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    295338 (Ptpn22)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     295338 (Ptpn22)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    295338 (Ptpn22)
SSDB
Motif
Pfam: Y_phosphatase Y_phosphatase3
Other DBs
NCBI-GeneID: 295338
NCBI-ProteinID: NP_001099930
RGD: 1307992
Ensembl: ENSRNOG00000019614
UniProt: D4A2D5
Position
2q34
AA seq 804 aa
MDQREILQQLLKEAQKKKINREEFANEFLKLKRQSTKYKADKIYPTTVAQRPKNIKKNRY
KDILPYDHSLVELSLLTSDEDSSYINASFIKGVYGPRAYIATQGPLSTTLLDFWRMIWEY
RVLVIVMACMEFEMGKKKCERYWAEPGETQLQFGPFSISCETEKKKSDYKIRTLKAKFNS
ETRIVYQFHYKNWPDHDVPSSIDPILQLIWDMRCYQEDDCVPLCIHCSAGCGRTGVICAV
DYTWMLLKDGIIPKNFSVFNLIQEMRTQRPSLVQTQEQYELVYSAVLELFKRHVDIISDN
HREREIQAECSIPEQKLTIEADSYPLDFPKNAVRDAKMTNQQSKQGAEAESTEVSSFGLR
TSKISAKEELVLHSKSSPSFDCLELNCECNKAVITRNGQARASLVVGEPLQKYQSLDFGS
ILFGSCPSALPINTASRCHNSKGPVKRTKSTPFELIQQRKTNELAVEDGSSCLESQLLEH
GLMELQAQKVAHASSEELNYSLPRACERPACDASCVPQDGPGALREHLCMSLAEDPYFSS
SPPNSAGSKMSFDLPEKQDGATSPGAQLPASSAASSSYSNPRDSLMESTLTSFPPPINQE
TAIEATSARTDDEIPPPLPERTPESFIVAEAAGEPSPSITESLPLAGKSGVTLECGGTSE
SQSHDLVAFTSSKNVELGSPKSDQHQDGSPPPPLPERTLESFFLADEDCIQAQPMKPSSI
SYPETTEISTSSKQTLKTPGKSFTRSKSLKIFRNMKKSVCNSPSPSKPTECVQPKNSSSF
LNFGFGTRFSKPKGPRNPPSTWNI
NT seq 2415 nt   +upstreamnt  +downstreamnt
atggaccaaagagaaattctgcagcagctactgaaagaggcccagaaaaagaaaattaac
agggaggagtttgccaatgaatttctgaagctgaaaaggcaatctaccaagtacaaggca
gacaaaatatatcctacaaccgtggctcagaggcccaagaatatcaagaaaaacagatac
aaggatattttgccctatgatcacagcctggtagagctgtctctgttaacgtccgatgag
gactccagttacatcaatgccagctttattaagggtgtctatgggcccagggcttatatt
gccactcagggtcctttatctacaactctcctggacttctggaggatgatctgggaatac
cgtgtcttggtcatcgtcatggcatgtatggagttcgaaatgggaaagaaaaagtgtgag
cgttattgggctgagccaggagaaacacagctgcaatttggccccttttctatatcctgt
gaaactgagaaaaagaaatctgattataaaatcaggactctgaaagccaagttcaatagt
gaaactcgaattgtttaccagtttcattataagaattggccggaccatgatgtgccttcc
tctatagaccctatccttcagctcatctgggatatgcggtgttaccaagaagacgactgc
gttcctctatgcattcattgcagtgccggctgcggaaggacgggggtcatttgtgctgtt
gattatacatggatgttgctgaaagatgggataattcctaagaacttcagtgtttttaat
ttgattcaggaaatgcgaacacagaggccttcgctagttcaaactcaggaacagtacgaa
ctggtctacagcgctgtgttggaactgtttaagaggcacgtggacattatctctgataat
caccgtgaaagagagattcaagcagaatgttcaattcctgaacaaaagctcactatagaa
gctgactcttatcctctggattttccaaaaaacgccgtgagagatgcaaaaatgacaaac
cagcagagcaaacaaggggcggaagcggagagcaccgaagtgtcttcctttggccttaga
acttctaagataagtgccaaggaagagttggttttgcactctaaatctagcccttctttt
gactgtttagagctaaactgtgagtgtaacaaggctgtcataaccaggaacgggcaggcg
agggcttctctggtcgtgggagagccgcttcagaagtatcaaagtctggacttcggttcc
atattgtttgggtcgtgtcctagtgctctgcccataaacacagcgagcagatgtcacaac
tcaaaggggccagtaaaacggaccaaatcaactcctttcgaactgattcagcagaggaaa
acaaacgagttagctgtggaagacggttcttcatgcttggaatctcagctgctcgagcac
ggtctcatggagttgcaggcgcaaaaagtggcccatgcttcttcagaagaactgaactat
tcattgccgcgtgcctgcgaacgcccggcatgtgatgcatcttgtgtaccgcaggacggc
cccggtgctttgagagagcatttgtgtatgtctttagcggaagatccttacttttcatca
tcccctccaaatagtgctggttctaagatgtcttttgatctgcctgagaaacaagatgga
gccacttctcctggtgctcagctgccagcctcttctgcagcctcctcttcttatagtaac
ccacgggattccttaatggagagcactctaaccagctttcccccgccaataaaccaagag
acagctatagaagccacttctgcaaggacagatgatgaaatccccccgccactccctgaa
cggacacctgagtccttcattgtggccgaagcagccggagagccctcgccaagcattact
gagtccttacctctggcaggaaaatctggagtgacactggaatgcgggggaacatctgag
tcacagagccatgacttggtggcgtttacgtcaagcaagaatgtggaactcggaagtccc
aaatcagatcaacatcaggatggttctcctccacctccactcccagaaagaactctggag
tccttctttcttgctgacgaggactgtatacaggcccaacccatgaaaccttcctctatt
agctatcctgaaaccacagagatctccacatcttctaagcaaacattgaagaccccagga
aaaagtttcacaaggagcaagagtttgaagattttccgaaatatgaaaaaaagtgtttgt
aattctccctcaccaagcaagcctacagaatgtgttcagccaaaaaattccagctccttt
ctgaattttggttttggaactcgtttttcaaaacccaaaggaccaaggaacccaccatca
acttggaatatttaa

DBGET integrated database retrieval system