KEGG   Rattus norvegicus (rat): 29534Help
Entry
29534             CDS       T01003                                 

Gene name
Pex2, Pxmp3
Definition
(RefSeq) peroxisomal biogenesis factor 2
  KO
K06664  peroxin-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    29534 (Pex2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    29534 (Pex2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    29534 (Pex2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pex2_Pex12 zf-C3HC4 zf-C3HC4_3 Prok-RING_4 zf-RING_UBOX zf-C3HC4_4 zf-C3HC4_2 zf-RING_5 zf-RING_2 zf-RING_6
Motif
Other DBs
NCBI-GeneID: 29534
NCBI-ProteinID: NP_058930
RGD: 61814
Ensembl: ENSRNOG00000008748
UniProt: P24392
Position
2q23
AA seq 305 aa AA seqDB search
MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL
WLFLWRFTIYSKNATVGQSVLNIQYKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC
YDLFPNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP
QSMREVGFEYMNRELLWHGFAEFLVFLLPLINIQKLKAKLSSWCIPLTSTAGSDSTLGSS
GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDMYFTCPKCGTEVHSVQPLKSGIEMS
EVNAL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggctgccagagaagagagtacacaaagtgccaacagagtgctgaggataagtcagctg
gatgcactggaactgaataaggccctggagcagctcgtgtggtcccagtttactcagtgt
tttcatggatttaagccaggactgttagctcgctttgagccagaagtgaaagcatttctg
tggcttttcctgtggaggttcaccatctattccaaaaatgccactgtggggcagtcggtt
ttaaatattcagtacaaaaatgattcttctcccaacccagtataccaaccaccaagtaaa
aatcagaaactgttgtatgctgtgtgcactattggggggaggtggttagaagaacgatgt
tacgatttgtttccaaaccgacatttagcatctttcgggaaagccaaacagtgcatgaat
tttgtggttggacttttaaaattaggtgagttgatgaacttcttgatttttctacaaaaa
ggaaagtttgcaactttgacagaacgcctccttggcattcattctgtattttgcaagccc
cagagcatgcgtgaagttggcttcgagtacatgaatagggaacttctctggcatggcttt
gccgaatttctggttttcctcttaccgctcatcaatatccagaagttgaaagccaagttg
tcttcctggtgcatcccccttaccagcactgctggtagtgacagtacactaggcagcagt
ggaaaagagtgtgctctatgtggagagtggcccacaatgcctcatactattggatgtgag
catgtattttgttactactgtgttaagagtagcttcctatttgacatgtactttacgtgc
cctaagtgtggcacagaagtgcacagtgtgcagccactgaaatcaggaattgaaatgtca
gaagtgaatgctctttaa

DBGET integrated database retrieval system