KEGG   Rattus norvegicus (rat): 295357Help
Entry
295357            CDS       T01003                                 

Gene name
Lamtor5, Hbxip
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
  KO
K16344  ragulator complex protein LAMTOR5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    295357 (Lamtor5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LAMTOR5
Motif
Other DBs
NCBI-GeneID: 295357
NCBI-ProteinID: NP_001099932
RGD: 1305005
Ensembl: ENSRNOG00000018186
UniProt: D3ZF11
Position
2q34
AA seq 156 aa AA seqDB search
MPANAGSVVVAMSFRKECERGATMNLFPLETPSARPPRSSHVTEACCEGGSVLPRGLGLG
RTVYGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKL
TSDPTDIPVVCLESDNGNVMIQKHDGITVAVHKMAS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgccagctaatgccggttctgtagtggtagctatgtcttttcgtaaagagtgcgaacgc
ggcgccacgatgaatttgttccctctggagacgccgtccgcgcgcccgcctcggtcaagt
cacgtgaccgaggcttgctgtgaaggaggaagtgttttgccgaggggtcttgggctgggg
cggacagtgtacgggatggaggcgactttggagcagcatttggaggacacaatgaagaat
ccatccattgttggagtcctatgcacagattcacaaggacttaatctgggctgccgtggt
accctgtcggatgagcatgctggagtgatatctgttctcgcccagcaggcagctaagctg
acctctgaccccaccgacatccctgtagtgtgtttagagtcagataacgggaatgttatg
atccagaaacacgatggcatcacagtggctgtgcacaaaatggcctcttga

DBGET integrated database retrieval system