KEGG   Rattus norvegicus (rat): 295365
Entry
295365            CDS       T01003                                 

Gene name
Amigo1, Amigo
Definition
(RefSeq) adhesion molecule with Ig like domain 1
  KO
K22529  amphoterin-induced protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    295365 (Amigo1)
SSDB
Motif
Pfam: LRR_8 LRR_4 I-set Ig_3 ig LRR_5 Ig_2 LRR_9 V-set Ig_6 Invasin_D3
Other DBs
NCBI-GeneID: 295365
NCBI-ProteinID: NP_996764
RGD: 1303079
Ensembl: ENSRNOG00000045665
UniProt: Q80ZD7
Position
2q34
AA seq 493 aa
MQPQRDLRGLWLLLLSLFLLLFEVARAGRPVVSCPANCLCASNILSCSKQQLPNVPQSLP
GYTALLDLSHNNLSRLKAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSN
HLHTLDEFLFSGLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNMISRFPLELIKD
ANRLPKLTLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQ
LSSVMDFQEDLYCVHSKKLHNVFSLDFFNCSEYKESAWEAHLGDTLTITCDTKQQGMTKV
WVTPSNEQVLNQGANGTVTVSEDGNLHFKEVQVEDGGVYTCYAMGETFNETLSVELKVYN
FTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS
TTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
SVSSVFSDTPIVV
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgcaaccccagcgtgacctgcgaggcctctggctcctgctgctctccttgttcctgctt
ctctttgaggtagctagggcaggccgacctgtggtcagttgtcccgccaattgcctgtgc
gccagcaacatcctcagctgctccaagcagcagctacccaatgtgccccaatctttgccg
ggctacacagcgctactggacctcagccacaacaacttgagccggctgaaggctgagtgg
acccccacccgtctgaccaacctgcactccctgctgctgagccacaaccacctgaacttc
atctcctctgaggccttcgtcccggtacccaaccttcggtacctggacctctcctccaac
catcttcacacgctggatgagttcctgttcagcggcctgcaggcactggaagtgctgctg
ctctacaataaccacattgtggtggtggaccggaatgccttcgaggacatggcccagctg
cagaaactctacctaagccagaatatgatctctcgatttcctctggaactgatcaaggat
gcaaacagattacccaaactaacgctcttggatctgtcctccaacaagctgaagaagttg
cccctgactgacctgcagaaattgccagcctgggtcaagaatgggctgtacctgcataac
aaccccctggagtgtgactgcaagctctaccagctcttttcacactggcagtaccggcag
ctgagttctgtgatggacttccaggaggatctgtattgcgtgcactccaagaagctgcat
aacgtcttcagtctggatttcttcaattgcagcgagtacaaggaaagtgcctgggaggct
cacctgggagacaccttgaccatcacgtgcgataccaaacagcaagggatgaccaaagtg
tgggtgaccccaagcaatgagcaggtgctaaaccagggggccaatggcacggtgaccgtg
tccgaggatggcaaccttcattttaaagaggtgcaggttgaggatgggggtgtgtatacc
tgctatgccatgggggagactttcaacgaaacactgtctgtggagttgaaagtgtataac
ttcaccttgcacggacaccatgacaccctcaacacagcctatactaccctggtgggctgc
atcctcagtgtggttctggtcctcatatacttgtacctcacaccttgccgctgctggtgc
cggggtgtggagaagccttccagccatcaaggagatagcctcagctcttctatgctcagt
accacacccaaccatgaccctatggctggtggggacaaagatgatggttttgaccggcgg
gtggccttcctggaacctgctggaccagggcagggtcaaaatggcaaactcaagccaggc
aacactctgccggtgcccgaggcaacaggcaagggccaacggaggatgtcagatccagag
tcggtcagctcggtcttttctgatacacccattgtggtgtga

DBGET integrated database retrieval system