KEGG   Rattus norvegicus (rat): 29538
Entry
29538             CDS       T01003                                 

Gene name
Ccl20
Definition
(RefSeq) C-C motif chemokine 20 precursor
  KO
K14625  C-C motif chemokine 20
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    29538 (Ccl20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29538 (Ccl20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29538 (Ccl20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    29538 (Ccl20)
   04062 Chemokine signaling pathway
    29538 (Ccl20)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    29538 (Ccl20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29538 (Ccl20)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   29538 (Ccl20)
SSDB
Motif
Pfam: IL8 NAD_synthase
Other DBs
NCBI-GeneID: 29538
NCBI-ProteinID: NP_062106
RGD: 3646
Ensembl: ENSRNOG00000015992
UniProt: P97884
Position
9
AA seq 96 aa
MACKHLPFLALAGVLLAYLCSQSEAASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDI
NAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM
NT seq 291 nt   +upstreamnt  +downstreamnt
atggcctgcaagcatctgcccttcctggctttggcgggggtactgctggcttacctctgc
agccagtcagaagcagcaagcaactttgactgctgcctcacgtacacaaagaacgtgtat
catcatgcgagaaattttgtgggtttcacaacacagatggccgacgaagcttgtgacatt
aatgctatcatctttcacctgaagtcgaaaagatccgtgtgcgctgacccaaagcagatc
tgggtgaaaaggattttgcacctcctcagcctaagaaccaagaagatgtaa

DBGET integrated database retrieval system