KEGG   Rattus norvegicus (rat): 295384
Entry
295384            CDS       T01003                                 

Gene name
Prmt6, Hrmt1l6
Definition
(RefSeq) protein arginine methyltransferase 6
  KO
K11437  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    295384 (Prmt6)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     295384 (Prmt6)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     295384 (Prmt6)
SSDB
Motif
Pfam: Methyltransf_25 PrmA Methyltransf_11 Methyltransf_9 MTS Met_10 CMAS Methyltransf_23 Methyltransf_31 Methyltransf_18 PRMT5 Methyltransf_24 Ubie_methyltran Cons_hypoth95 Methyltransf_16 Methyltransf_12 NNMT_PNMT_TEMT FtsJ PCMT
Other DBs
NCBI-GeneID: 295384
NCBI-ProteinID: NP_001099936
RGD: 1304701
Ensembl: ENSRNOG00000017187
UniProt: D4A307
Position
2q41
AA seq 375 aa
MSLSKKRKLESGVGGAGGEGAEEENGGEQEAAPPRPRRTKRERDQLYYECYSDVSVHEEM
IADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQA
QEVVRLNGLEDRVHILPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKE
GGLLLPDSAELFVAPISDQMLEWRLGFWSQVKQHYGVDMSCMESFATRCLMGHSEIVVQG
LSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYGSAPLHGFAIWFQVTFPGGD
SEKPLVLSTSPFHPATHWKQALLYLNEPVPVEQDTDISGEITLLPSRDNPRRLRVLLRYK
VGDHEEKTKDFAMED
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcgctgagcaagaaaagaaagcttgagtcgggggtcggcggcgcaggaggggaggga
gctgaggaggaaaatggcggggagcaggaggcagccccgccacgaccccggaggaccaag
cgcgagcgggaccagctgtactacgagtgctactccgacgtatcggtccacgaggagatg
atcgccgaccgcgtccgcaccgacgcctaccgcctaggcatcctgaggaactgggccgct
ctgcgaggcaagaccgtgctggacgtgggcgcaggcaccggcattcttagcatcttctgc
gcccaggccggggcccggcgcgtatacgctgtggaggccagcgccatctggcaacaggcc
caggaggtggtgcggctcaacgggttggaggaccgcgtgcacatcctgccaggcccggtg
gagacggtggagctgccggagcaagtggacgccatcgtaagcgagtggatgggctacgga
ctactgcacgagtccatgctgagctccgtgctccacgcgcggaccaaatggctgaaggag
ggcggtctcctcctgccagattccgctgagctcttcgtggccccgattagcgaccagatg
ctggaatggcgcttgggtttctggagccaagtgaagcagcactatggcgtggatatgagc
tgcatggaaagcttcgccacgcgctgcctcatgggccattcggagatcgtggtgcagggt
ctgtccggagaggacgtgctggcccggccacagcgctttgcccagctcgagctggcccgc
gctggcctggagcaggagctggaggccggtgtgggcgggcgcttccgctgcagctgctat
ggctccgcgcctctacatggttttgccatctggtttcaggtaacctttcctggaggggac
tcggagaaacctctggtgctgtccacctcacctttccacccggccacgcactggaagcag
gcgctcctctacttgaatgagccggtgccggtggaacaagatacagacatttctggagag
atcaccctgctgccctcccgggacaacccccggcgtctgcgcgtacttctgcgctacaaa
gtgggggaccatgaggaaaagaccaaagactttgccatggaggactga

DBGET integrated database retrieval system