KEGG   Rattus norvegicus (rat): 29541Help
Entry
29541             CDS       T01003                                 

Gene name
Nthl1, Nth1
Definition
(RefSeq) nth-like DNA glycosylase 1
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    29541 (Nthl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    29541 (Nthl1)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     29541 (Nthl1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     29541 (Nthl1)
 Prokaryotic type
     29541 (Nthl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD HHH
Motif
Other DBs
NCBI-GeneID: 29541
NCBI-ProteinID: NP_001099198
RGD: 1309289
Ensembl: ENSRNOG00000012213
UniProt: D4A4E8
Position
10q12
AA seq 300 aa AA seqDB search
MNSGLRIVTRSRSRATRIASEGCREELAPRETAAEGRKSHKPVRRPRKKQKVHVAYEVAN
GEEGEDAEPLKVPVWEPQNWQQQLANIRIMRSKKDAPVDQLGAEQCYDITAPPKVRRYQV
LLSLMLSSQTKDQVTAGAMQRLRARGLTVESILQTDDDLLGRLIYPVGFWRSKVKFIKQT
TAILQQRYEGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLKWT
KKMTKSPEETRRNLEEWLPRVLWSEINGLLVGFGQQICLPVHPRCQACLNKALCPAAQGL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaactcggggttgcggatagtgactcgcagtcggagccgcgcgactaggatcgcgtcg
gaagggtgtagggaggagctcgccccgcgagagactgctgcagaaggaagaaaaagccac
aagcctgtgagacgtccacggaagaaacagaaagtacatgtggcctatgaggttgctaac
ggtgaggaaggtgaagatgctgaacccctcaaagtgccagtttgggagccccaaaactgg
cagcagcaactggccaacatccgaatcatgagaagcaagaaggacgcacctgtggaccag
ctgggcgctgagcagtgctatgatatcactgcccccccaaaggtgaggaggtaccaggta
ctcttgtcgctgatgctgtccagccagaccaaagaccaggttacagcgggtgccatgcag
cggctacgggcccggggcttgactgtggaaagtatcctgcagaccgatgatgacttgctg
ggcagactcatctaccccgtgggcttctggaggagcaaggtaaaattcatcaagcagacg
actgccatcctgcagcagcgctatgaaggggacatccctgcttctgtggcagagctggta
gccttgccaggtgttgggcccaagatggcacacttggctatggctgtggcctgggggacc
gtatcaggcatagcagtggacacacatgtgcacagaatagccaacagactgaagtggacc
aagaagatgaccaagtccccagaggagacacgtaggaacctggaagagtggctacccagg
gtgctatggagtgagatcaatggactactggtgggcttcggccaacagatttgccttcct
gtccatccacgatgccaggcctgcctcaacaaggccctgtgtcctgctgcccagggtctc
tga

DBGET integrated database retrieval system