KEGG   Rattus norvegicus (rat): 29543
Entry
29543             CDS       T01003                                 

Gene name
Timp2
Definition
(RefSeq) TIMP metallopeptidase inhibitor 2
  KO
K22583  metalloproteinase inhibitor 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29543 (Timp2)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I35: timp family
   29543 (Timp2)
SSDB
Motif
Pfam: TIMP NTR
Other DBs
NCBI-GeneID: 29543
NCBI-ProteinID: NP_068824
RGD: 61312
Ensembl: ENSRNOG00000003148
UniProt: P30121
Position
10q32.3
AA seq 220 aa
MGAAARSLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGND
IYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDG
KMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTE
KSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
NT seq 663 nt   +upstreamnt  +downstreamnt
atgggcgccgcggcccgcagcctccggctggcgctcggcctcctgctgctggccacgctg
ctgcgcccggccgacgcctgcagctgctccccggtgcacccgcaacaggcgttttgcaat
gcagacgtagtgatcagggccaaagcagtgagcgagaaggaggtggattccgggaatgac
atctatggcaaccccatcaagaggattcaatatgagatcaagcagataaagatgttcaaa
ggacctgacaaggacatcgaatttatctacacggccccctcctcagcagtgtgcggggtc
tcgctggacgttggaggaaagaaggaatatctaattgcagggaaggcggaaggagatggc
aagatgcacattaccctctgtgactttattgtgccctgggacacgcttagcatcacccag
aagaagagcctaaaccacaggtaccagatgggctgcgagtgcaagatcacacgctgccct
atgatcccatgctacatctcctccccggatgagtgcctctggatggactgggtcacagag
aagagcatcaatgggcaccaggccaagttctttgcctgcatcaagagaagtgatggttct
tgcgcgtggtaccgcggggcggcacccccgaagcaggagtttcttgacatcgaggacccg
taa

DBGET integrated database retrieval system