KEGG   Rattus norvegicus (rat): 295461Help
Entry
295461            CDS       T01003                                 

Gene name
Sec24b
Definition
(RefSeq) SEC24 homolog B, COPII coat complex component
  KO
K14007  protein transport protein SEC24
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    295461 (Sec24b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    295461 (Sec24b)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    295461 (Sec24b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin Sen15 HpaB
Motif
Other DBs
NCBI-GeneID: 295461
NCBI-ProteinID: NP_001099944
RGD: 1309358
Ensembl: ENSRNOG00000023373
Vega: OTTRNOG00000002327
UniProt: D3ZW15
Position
2q42
AA seq 1242 aa AA seqDB search
MSAPAGSPHPAAGARMPPKLGGAVSGLAPPQQNGPAQSQMQVPSGYGLPHQNYMAPSGHY
SQGPGKMTSLPLDNQCENYYSRPYTAPTQNVGTPSSANQPGAQLMYGRGPSAPHMGASMP
GPFQGAPASASHSYPSASQPYSSLGNRYSSPATYSATASVASQGYPSTCSHYPISTVSNV
VYPNVSYPSLPASEPYGQMFTSQSAPPPARPLKESYSGPSTAVAYPSRPPPPPSQHQQQQ
QQQQQQQQQSHSGYSSLPWSGPGLPPAQDSLIRNQMGSLAIPNSHPAINENVQPPKPSSV
VATVLPGPSSTRMPPAPSHPVGPVPSAPPPPEQMQTKGMQYGDYVNNQASSTPTPLSSAS
DDEEEEDEDEEAGVDSSSTTSSASPLPNSYDALEGGSYPDMHSSSASSPVPDRAPEPNST
LVPTPTAAQPAKVAKPFGYGYPTLQPAYQNAAAPPTTAHPSGPAYSGYPQQYPGVHQLSS
GLGGLSLQSSPQPESLRPVNLTQEKNILPATPIWAPVPNLSAELSKLNCSPDSFRCTLTS
IPQTQALLNKAKLPLGLLLHPFRDLTQLPVITSNTIVRCRSCRTYINPFVSFIDQRRWKC
NLCYRVNDVPEEFLYNPLTRSYGEPHKRPEVQNSTVEFIASSDYMLRPPQPAVYLFVLDV
SHNAVEAGYLTVLCQSLLENLDKLPGDSRTRIGFMTFDSTIHFYNLQEGLSQPQMLIVSD
IDDVFLPTPDSLLVNLYESKELIKDLLNALPNMFINTRETHSALGPALQAAFKLMSPTGG
RVSVFQTQLPSLGAGLLQSREDPNQRSSTKVVHHLGPATDFYKKLALDCSGQQTAVDLFL
LSSQYSDLASLACMSKYSAGCIFYYPSFHSTHNPSQAEKLQKDLKRYLTRKIGFEAVMRI
RCTKGLSMHTFHGNFFVRSTDLLSLANINPDAGFAVQLSIEESLADTSLVCFQTALLYTS
SKGERRIRVHTLCLPVVSSLADVYAGVDVQAAICLLANMAVDRSVSSSLSDARDALVNAV
VDPLSAYSSAVSSVPRSTLTAPSSLKLLPLYVLALLKQKAFRTGTSTRLDDRVYAMCQMK
SQPLVHLMKMIHPNLYRIDRLTDEGAIHVNDRVVPQPPLQKLSAEKLTREGAFLMDCGSV
FYIWIGKGCDSNFIENVLGYPDFGSIPQKMTHLPELDTLPSERTRSFVTWLRDSRPLSPV
LHVVKDESPARTDFFQHLVEDRTEAALSYYEFLIHVQQQVCK
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccccgccgggtcccctcacccggccgccggcgcccggatgccgcccaagctc
ggcggagcagtctctggcctggcgccgccgcagcagaatggtccagcacagagtcaaatg
caagttccatctgggtatgggctgcctcatcaaaactatatggccccctcaggacactac
tctcaaggacctgggaaaatgacctccttgccgttggataaccagtgtgagaattactac
tctcgtccatatacagcaccaacacagaatgtggggactcccagctcagcaaaccaacca
ggagcacagctcatgtatggcagaggtccttctgcccctcacatgggggcatccatgcca
ggacctttccaaggagctccagcatcggcgtcccattcgtacccgagtgcctcccagccc
tattcctctcttgggaaccgctacagtagtcctgccacatactccgccaccgcttctgtt
gcttctcagggatacccctccacttgtagtcattatcccatctccactgtgtctaatgtc
gtgtatcctaacgtttcatacccctcgctgcctgccagtgagccgtatgggcagatgttt
acctcacagagtgctcctccgcctgccaggccacttaaagagtcatactctggcccaagc
acagctgttgcctacccatcgagacctccgcctccaccttcccagcaccagcagcagcag
cagcagcagcagcagcagcagcagcagagtcattcaggatacagttctctaccatggtca
ggtccaggccttccaccagcccaagacagtctcatccgaaaccaaatgggatccttggct
ataccgaacagccacccagcaattaacgaaaatgtccaaccacctaagcccagctccgta
gtagccacagttttgccaggaccctcatcaacaagaatgccacctgccccaagtcaccca
gttgggcctgtgccgtctgctccaccccccccagagcagatgcagacaaaaggcatgcag
tatggtgactatgttaataatcaagctagctccacaccaactcccttgtcatcagcttcc
gatgatgaggaagaggaggatgaggatgaggaagcaggtgttgacagctcttctaccaca
agcagcgcttcgcccttgcccaacagttatgatgccttggaaggaggaagctacccagat
atgcattcttcttcagcaagcagccccgttcctgatcgtgccccggaacctaactccacc
ctcgtccccactcccactgctgctcagccagccaaggtagcaaagccttttggctatggc
tacccaacgctgcagcctgcttatcagaatgcagcagcaccacccaccacagcccacccc
agcgggccagcgtattctggatatcctcagcagtatccaggtgtgcaccaactgtcctca
ggtctgggagggctaagcctgcagagctctccacagccagaaagcctacggcctgtgaac
ctcacccaggagaagaacatcttacctgcaactcccatttgggcacctgtacctaacctg
agtgcagagctcagcaagttaaactgtagcccagactcgtttcgatgtaccttgaccagt
atcccacagacacaggctttactgaataaagctaagcttcccttgggactgctgctgcac
cccttcagagacctgacgcaattgccagtgataacctccaacaccattgtgaggtgccgg
tcctgtcggacgtacatcaacccttttgtgtccttcatcgatcagcgcaggtggaaatgc
aacctgtgctacagagtgaatgatgttccagaagagtttttgtacaaccccctgactcgg
tcttacggagagcctcataaacggccggaagttcagaattcaactgtggagttcatcgct
tcctcagactacatgctccggcctcctcagcctgcagtctacttgtttgttttagatgtg
tctcataacgcagtggaagctgggtacttgacagttctatgccagtccttattagaaaac
ttagacaagcttcctggagactcacgaacaagaataggattcatgactttcgacagcact
attcatttctacaatttacaagaaggattatcccagcctcagatgttgattgtatctgat
atagacgatgttttcttgcccacaccggatagtctgcttgtgaatctgtatgaaagtaaa
gagcttataaaagacttactgaacgcattaccaaatatgttcatcaataccagagaaacg
cacagtgctcttggacctgcacttcaggctgccttcaaactaatgtctcccacgggcgga
cgagtgtctgtgtttcagacacagttaccttccttgggggcaggacttctgcagtccaga
gaagatccgaatcagaggtcgagcaccaaggtggtgcaccatctcggccctgccaccgac
ttttataagaaacttgctttagattgctcaggacagcagaccgcagtggatttgttcctg
ctaagttcacagtattctgacctcgcttctctggcctgcatgtccaagtactccgcaggg
tgcatattctactacccatcgttccactccacccacaacccttcgcaagcagagaagtta
cagaaagacctaaaacggtacctcaccaggaagatcggatttgaagctgttatgaggata
agatgtaccaaaggactttcgatgcacactttccacgggaacttctttgtccggtccact
gacttgctgtctcttgccaacatcaatcctgatgctgggtttgcagtgcagttgtcaatt
gaggaaagcctggcggacacttccctggtgtgcttccagactgccctgctgtacacatca
agcaaaggtgagcggagaattcgagttcacacactgtgcttgccagtggtgagttcactg
gctgatgtttatgcaggagtggatgtgcaagctgccatctgccttctggccaacatggct
gtggaccgctcagtgtcatccagcctgtcggatgccagggacgccctggtgaatgccgtg
gtggatcccctgtctgcctacagctctgcagtgtcgagtgtgccccgctccaccctgaca
gcaccgagctcactgaagctgctccctctctatgttctggcacttctcaaacagaaagca
tttagaacaggtacaagcacgcgcctggacgaccgtgtgtacgccatgtgccagatgaag
tcgcagccacttgtgcatctaatgaaaatgattcatcccaacttgtacaggatagaccgg
ctgacggatgagggtgccatacatgtcaacgacagggtagtaccccagccacctcttcaa
aaactgtctgcagagaaactgaccagagaaggtgctttcctcatggactgtggctcagtt
ttctacatttggattggcaaaggctgtgacagtaatttcatagagaatgtgcttgggtat
cctgattttggatcaataccacagaaaatgacacatcttccagagctagacacacttccg
tcagagagaactagatcctttgtaacttggctcagagacagccgaccattaagccctgtc
cttcacgtggtaaaagatgagagtcctgccagaacagactttttccagcatttggtggaa
gaccgcaccgaagccgcactctcctactatgagtttctgattcacgttcagcagcaggtt
tgtaagtga

DBGET integrated database retrieval system