KEGG   Rattus norvegicus (rat): 29547
Entry
29547             CDS       T01003                                 

Gene name
Homer2
Definition
(RefSeq) homer protein homolog 2
  KO
K15010  homer
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    29547 (Homer2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29547 (Homer2)
SSDB
Motif
Pfam: WH1 Macoilin GAS DUF812 Jnk-SapK_ap_N MAD CENP-F_leu_zip DMPK_coil VGPC1_C CLZ Effector_1 TolA_bind_tri Phage_GP20 FPP Crescentin Dor1 DUF4201
Other DBs
NCBI-GeneID: 29547
NCBI-ProteinID: NP_445761
RGD: 620705
Ensembl: ENSRNOG00000061450
UniProt: O88801
Position
1
AA seq 354 aa
MGEQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVREAARLARDKSQEK
IETSSNHSQESGCETPSSTQASSVNGTDDEKASHASPADTHLKSENDKLKIALTQSAANV
KKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRSKIEELEEQCGEIN
REKEKNTQLKRRIEELESEVREKEMELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQN
LEDKVRSLKTDIEESKYRQRHLKGELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggagagcagcccatcttcaccacgcgagcgcacgtcttccagattgaccccagcacc
aagaagaactgggtgccggcaagcaagcaggccgtcactgtttcctacttctacgatgtc
accaggaacagctatcggatcatcagtgtggatggagccaaggtaatcataaacagcacc
atcaccccgaacatgacgttcaccaaaacttcacagaagttcgggcagtgggctgacagc
agggccaacaccgtgttcggtctgggattctcctcagagcagcagctcacaaagtttgca
gagaaattccaggaggtaagagaagctgccaggttagccagagacaagtcccaggagaaa
atcgagacgtcaagtaatcattcccaagaatctgggtgtgaaaccccgtcttccactcag
gcatccagcgtcaatgggacagatgacgagaaagcctcccatgcgagtccggccgacaca
cacctcaagtctgagaatgacaagctgaagatcgctttgacacagagtgctgccaatgtg
aagaagtgggagatcgagctgcagaccctgcgggagagcaatgcccggctgaccaccgcg
ctgcaggagtcggcggccagtgtagaacagtggaagcggcaattctccatctgcagagat
gagaatgacaggctccgcagcaagattgaggagctggaagaacagtgcggtgagatcaac
agggagaaggaaaagaacacccagctgaagaggaggattgaggagctggagtcagaggtc
cgagaaaaggaaatggagttgaaggatctccgcaaacaaagtgaaatcatacctcagctc
atgtccgagtgtgaatatgtctctgagaagttagaggctgcagaaagagacaatcaaaac
ttggaagacaaagtgcggtctctaaagacagacatcgaggagagtaaataccggcagcgc
cacctgaagggggagctcaagagcttccttgaggtgctggacggaaagatcgatgacctc
cacgacttccgccgagggctctccaagctaggcacggataactag

DBGET integrated database retrieval system