KEGG   Rattus norvegicus (rat): 29553
Entry
29553             CDS       T01003                                 

Symbol
Kcnk3
Name
(RefSeq) potassium channel subfamily K member 3
  KO
K04914  potassium channel subfamily K member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    29553 (Kcnk3)
   04927 Cortisol synthesis and secretion
    29553 (Kcnk3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    29553 (Kcnk3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29553 (Kcnk3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   29553 (Kcnk3)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 29553
NCBI-ProteinID: NP_203694
RGD: 61997
Ensembl: ENSRNOG00000009790
UniProt: O54912
Position
6
AA seq 411 aa
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQLELRARYNLSEGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIGFVSCISTLCIGAAAFSY
YERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTHNGQAGGLGGLSCLSGSLGDGVRPRDPVTCAAAAG
GMGVGVGVGGSGFRNVYAEMLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEHS
HSSPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLATFRGLMKRRSSV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaagcggcagaatgtgcgcacgttggctctcatcgtgtgcaccttcacctacctgctg
gtgggcgccgcggtgttcgacgcgctggagtcggagccggagatgatcgagcggcagcgg
ctggagctgcggcagctggagctgcgggcgcgctacaacctcagcgagggcggctacgag
gagctggagcgcgtcgtgctgcgcctcaagccgcacaaggccggcgtgcagtggcgcttc
gccggctccttctacttcgccatcaccgtcatcaccacaatcggctatggtcatgcggct
cccagcacggacggaggcaaggtgttctgcatgttctacgcgctgctgggcatcccgctc
acactagtcatgttccagagcctgggtgaacgcatcaacaccttcgtgaggtacctgctg
caccgtgcgaagagggggctgggcatgcggcacgccgaggtgtccatggccaacatggtg
ctcatcggtttcgtgtcgtgcatcagcacgctgtgtatcggcgccgctgccttctcctac
tatgagcgctggactttcttccaggcctattactactgcttcatcaccctcaccaccatc
ggcttcggcgactacgtggcgctgcagaaggaccaggcgctgcaaacgcagcctcagtac
gtggccttcagcttcgtatacatcctcaccggcctcacggtcatcggcgccttcctcaac
ctcgtggtgctgcgattcatgaccatgaacgccgaggacgagaagcgtgatgcagagcac
cgtgcgctgctcacgcacaatggccaggctggcggcctgggtggcctgagctgcctaagc
ggtagcctgggcgatggcgtgcgtccccgcgacccagtcacttgcgcagcggctgcaggc
ggcatgggcgtgggcgtgggcgtcggtggcagcggcttccgcaacgtctatgctgaaatg
ctgcactttcagtccatgtgctcgtgcctctggtacaagagccgcgagaagctgcagtac
tccatccccatgatcatcccgcgggacctctccacatccgacacgtgcgtggagcacagc
cactcgtcgccaggaggcggcggccgctacagcgacacgccctcacacccttgcctgtgc
agcgggacgcaacgctcggccatcagctccgtgtccacgggcctgcacagcctggctacc
ttccgcggcctcatgaagcgcaggagctcagtgtga

DBGET integrated database retrieval system