KEGG   Rattus norvegicus (rat): 29555
Entry
29555             CDS       T01003                                 

Gene name
Vipr2
Definition
(RefSeq) vasoactive intestinal peptide receptor 2
  KO
K04590  vasoactive intestinal peptide receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    29555 (Vipr2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29555 (Vipr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29555 (Vipr2)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    29555 (Vipr2)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 29555
NCBI-ProteinID: NP_058934
RGD: 3962
Ensembl: ENSRNOG00000004317
UniProt: P35000
Position
6q33
AA seq 437 aa
MRASVVLTCYCWLLVRVSSIHPECRFHLEIQEEETKCAELLSSQMENHRACSGVWDNITC
WRPADIGETVTVPCPKVFSNFYSRPGNISKNCTSDGWSETFPDFIDACGYNDPEDESKIT
FYILVKAIYTLGYSVSLMSLTTGSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDS
VLYSSSGTLRCHDQPGSWVGCKLSLVFFQYCIMANFYWLLVEGLYLHTLLVAILPPSRCF
LAYLLIGWGIPSVCIGAWIATRLSLEDTGCWDTNDHSIPWWVIRMPILISIVVNFALFIS
IVRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQILFEL
CVGSFQGLVVAVLYCFLNSEVQRELKRRWRGLCLTQPGSRDYRLHSWSMSRNGSESALQI
HRGSRTQSFLQSETSVI
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgagggcgtcggtggtgctgacctgctactgctggttgctggtgcgggtgagcagcatc
cacccagaatgccggtttcatctggaaatacaggaagaggagacaaaatgcgcagagctg
ctaagcagccaaatggagaatcacagagcttgcagcggtgtctgggacaacatcacatgc
tggcgccctgcagacattggggaaactgtcacagtgccctgccccaaagtgttcagcaat
ttctacagcagaccaggaaacataagcaaaaactgcactagtgatgggtggtcggagaca
tttccggatttcatagatgcgtgtggctacaacgaccccgaggatgagagtaagatcacg
ttttatattctggtgaaggccatttataccttgggctacagtgtttctctgatgtctctt
acaacaggaagcataattatctgcctcttcaggaagctgcactgcacaaggaactacatc
cacctgaatctgttcctctccttcatgctgagagccatctctgtgctggtcaaggacagt
gtgctctactccagctcaggtacactgcgctgccacgaccagccgggctcctgggttggc
tgcaagctcagcctggtattcttccagtactgtatcatggcgaacttctactggcttctg
gtggagggtctctacctgcacaccctcctggtagccatccttcctcccagcaggtgtttc
ctggcctaccttcttattggatggggtatccccagtgtgtgtataggtgcatggatagca
actcgcctttctttagaagacacaggttgctgggacacgaacgaccacagcatcccctgg
tgggtcattcggatgcccattctaatttctattgtagtcaactttgccctcttcatcagc
attgtaaggatcttacttcagaagctaacttctccagatgttggtggcaatgaccagtca
cagtacaagaggctcgccaagtccacactgctgctaatcccactgtttggcgtccactac
atggtgtttgctgccttccccattggcatctcctccacgtaccagatcctgtttgagtta
tgtgttggttccttccagggcctggtggtcgcagttctatattgctttctgaacagtgag
gtacagcgtgaactgaaaagaaggtggagaggcctgtgcctgacccagcctgggagccgg
gactaccggctgcacagctggtccatgtcccggaatggctcagaaagcgccctacagata
caccgtggctcccgtacccagtccttcctgcagtcagagacctcagtcatttag

DBGET integrated database retrieval system