KEGG   Rattus norvegicus (rat): 295586Help
Entry
295586            CDS       T01003                                 

Gene name
Clcn6
Definition
(RefSeq) chloride voltage-gated channel 6
  KO
K05015  chloride channel 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    295586 (Clcn6)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel (CLC)
   295586 (Clcn6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Voltage_CLC CBS DUF2140
Motif
Other DBs
NCBI-GeneID: 295586
NCBI-ProteinID: NP_001099949
RGD: 1305379
Ensembl: ENSRNOG00000008345
UniProt: D4A3H5
Position
5q36
AA seq 870 aa AA seqDB search
MAGCRGSVCCCCRWCCCCGERESRTPEELTILGETQEEEDEILPRKDYESLDYDRCINDP
YLEVLETMDNKKGRRHEAVKWMVVFAIGVCTGLVGLFVDFSVRLFTQLKFGVVQTSVEEC
SQKGCLALSLLELLGFNLTFVFLASLLVLIEPVAAGSGIPEIKCYLNGVKVPGIVRLRTL
LCKVFGVLFSVAGGLFVGKEGPMIHSGAVVGAGLPQFQSISLRKIQFNFPYFRSDRDKRD
FVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKVLFCSMSATFTLNFFRSGIQF
GSWGAFQLPGLLNFGEFKCSDSDKKCHLWTAMDLGFFVVMGVIGGLLGATFNCLNKRLAK
YRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGECRQMSSTSQTGNGSFQLQVTSE
DVNSTIKTFFCPNDTYNDMATLFFNSQESAILQLFHQDGTFSPVTLALFFALYFLMACWT
FGTSVPSGLFVPSLLCGAAFGRLVANVLKSYIGLGHLYSGTFALIGAAAFLGGVVRMTIS
LTVILIESTNEITYGLPIMVTLMVAKWTGDFFNKGIYDIHIGLRGVPLLEWETEVEMDRL
RASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKF
KKSSILTRAGEQRKRGQSMKSYPSSELRNVCDEHVASEEPAEKEDLLQQMLERRYTPYPN
LYPDQSPSEDWTMEERFRPLTFHGLVLRSQLVTLLVRGVCYSESQSSASQPRLSYAEMAE
DYPRFPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVN
AVGEIVGIITRHNLTTEFLQARLRQHYQTL
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtgcagggggtctgtgtgctgctgctgcaggtggtgctgctgctgcggcgaa
cgcgagagccgcactcccgaggagctgaccatccttggggagacacaggaagaggaagat
gagatccttccaaggaaagactatgagagtctggactatgaccgctgtatcaacgaccct
tacctggaggtattggagaccatggataataagaaagggcgaagacatgaggcggtgaag
tggatggtggtgtttgccattggcgtctgtactgggctggtgggcctcttcgtggacttt
tctgtgcgactcttcacccaactcaagttcggagtggttcaaacgtcggtggaggaatgc
agtcagaaaggctgccttgccctgtctctcctggaactccttggctttaacttgaccttt
gtcttcctggcaagccttcttgtcttgatagagccggtggcagcaggctctggaatccca
gagatcaagtgctatctgaatggtgtgaaagtgccaggaattgtccggctccgaaccctg
ctctgcaaagtctttggggtgctgttcagtgtggctggagggctctttgtggggaaagaa
ggccccatgatccacagtggtgccgtggtaggagctggcctccctcagtttcagagcatc
tccttaaggaagatccagtttaacttcccctacttccgcagcgacagagacaagcgtgac
ttcgtatcagcaggggcggctgctggagttgctgcagcttttggggcccctatagggggc
accttgttcagcctggaggagggctcgtccttctggaaccagggactcacgtggaaagtg
ctcttctgttccatgtctgccaccttcaccctcaacttcttccgctctgggatccagttt
ggaagttggggtgccttccagctgcctggactgctgaactttggtgaatttaagtgctct
gactctgataaaaaatgtcatctctggacagctatggatttgggtttcttcgtcgtgatg
ggggtcattgggggcctcctgggagccacattcaactgtctgaacaagaggcttgcaaag
taccgtatgcgcaacgtgcacccgaaacctaagctcgtcagggtcttagagagcctcttg
gtgtccctggtgacgactgtggtggtgtttgtggcctccatggtgttgggagaatgccga
cagatgtcttccacgagtcaaacgggtaatggctcattccagctccaggtcacatcggaa
gatgtgaattcaactatcaagacatttttctgtcccaatgacacctacaacgacatggcc
acactcttcttcaactcccaggagtctgccatcctgcagctcttccatcaggatgggact
ttcagccccgtcaccctggccttattcttcgccctctatttcctgatggcatgctggact
ttcggcacctctgtccccagtggcctcttcgtgccttccctgctgtgtggagcagctttt
ggacgtttagttgccaatgtcctgaaaagctacattggactgggccacctctattctggg
accttcgccctgattggtgcggcagctttcttgggtggggttgtaagaatgaccatcagc
ctcacagtcatcctgattgagtccacaaatgagatcacctatgggcttcctattatggtc
actttgatggtggccaagtggactggagactttttcaataagggcatttacgacatccac
attgggctgagaggtgtgcctcttctggagtgggagacagaggtggagatggacaggctg
agagccagcgacatcatggagcccaacttgacgtatgtctacccacatactcgtatccag
tctctggtgagcatcctgcgtactacagtccaccatgccttcccagtggtcacagagaat
cgcggcaacgagaaggagttcatgaaaggcaaccagctcataagcaacaacattaagttc
aagaagtccagcatcctcacccgtgctggtgagcagcgcaagcggggccagtccatgaag
tcttacccttccagcgagctgcgcaacgtgtgtgatgagcatgtggcttctgaggagcca
gcagagaaggaggacctgctacagcagatgctggagaggagatacactccctaccccaac
ctataccctgaccagtccccgagtgaagactggaccatggaggagcgattccgtccgctg
accttccatggcctcgtcctgcgctcccagctcgtcaccctgctcgtccgaggcgtgtgt
tactcggaaagtcagtccagtgccagccaaccacgcctttcttatgctgagatggctgag
gactacccgaggtttccggacatacatgacctggacctcacactgctgaatccccgcatg
attgtggacgtcacaccatatatgaatccttcaccatttactgtctcccccaacacccac
gtttctcaagttttcaacctgttcagaaccatgggcctgcgccacttgccggtggtgaat
gcggtgggcgagatcgtggggatcattacacgacacaacctgacgactgagttcctgcag
gcccggctacggcagcattaccagaccctctga

DBGET integrated database retrieval system