KEGG   Rattus norvegicus (rat): 29559Help
Entry
29559             CDS       T01003                                 

Gene name
Grik1, GluK1, GluR5
Definition
(RefSeq) glutamate ionotropic receptor kainate type subunit 1
  KO
K05201  glutamate receptor, ionotropic kainate 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29559 (Grik1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29559 (Grik1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29559 (Grik1)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   29559 (Grik1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 29559
NCBI-ProteinID: NP_001104587
RGD: 2732
Ensembl: ENSRNOG00000001575
UniProt: P22756
Structure
PDB: 

Position
11q11
AA seq 949 aa AA seqDB search
MERSTVLIQPGLWTRDTSWTLLYFLCYILPQTSPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDSRDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPPANKDAKPLLKEMKKSKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEGTEKASGEVSKHLYKVWKKIGI
WNSNSGLNMTDGNRDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCL
DLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREK
VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTL
IIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKM
WAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSKEASALGVENIGGIFI
VLAAGLVLSVFVAIGEFLYKSRKNNDVEQKGKSSRLRFYFRNKVRFHGSKKESLGVEKCL
SFNAIMEELGISLKNQKKLKKKSRTKGKSSFTSILTCHQRRTQRKETVA
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagcacagtccttatccaacccgggctctggaccagggacaccagctggaca
ctcctctatttcctgtgctacatcctccctcagacctcccctcaagtgctcaggatcgga
gggatttttgaaactgtggaaaatgaacctgttaatgttgaagaattagctttcaagttt
gcagtcaccagtattaaccgaaaccgaaccttgatgcccaataccacattaacctatgac
atccagagaattaatctttttgatagttttgaagcctcccgaagagcatgcgaccagctg
gctctcggggtggccgcactcttcggcccttcccacagctcctccgtcagtgctgtacag
tctatttgcaatgctctggaagttccacacattcagactcgctggaaacacccttccgtg
gacagcagagacctattttatatcaacctctacccggactatgcggctatcagcagggcg
gtcctggatttggtcctctattacaactggaaaacagtgacggtggtgtatgaagacagc
acaggtctaattcgtctgcaagagctcatcaaagctccctccagatacaacattaaaatc
aaaatccgccagcttccccctgcgaataaagacgccaaacctctgctcaaggagatgaag
aaaagcaaagagttctatgtgatatttgattgttcgcacgaaacagctgcggaaattctt
aagcagattttgttcatgggcatgatgactgaatattatcactacttcttcacaaccctg
gacttgtttgctttagatctggaactctataggtacagcggtgtaaatatgactggattt
cggttgctgaatattgacaaccctcacgtgtcatccatcattgagaagtggtccatggag
aggttgcaggccccgcccagacccgagactggtcttctggatggcatgatgacaactgaa
gcagcgctgatgtacgatgctgtgtacatggtagccattgcgtcccaccgtgcctctcag
ctgaccgtcagctccctgcagtgccatcgacataagccatggcgccttggacccagattt
atgaacctcatcaaagaggctcggtgggacggcttgactgggcggatcaccttcaataag
accgatggcttgagaaaggattttgacctggacattatcagtctcaaagaggaaggaact
gaaaaggcctctggtgaagtgtctaaacacttgtataaagtgtggaagaagattgggatt
tggaactccaacagtgggctgaacatgacggatggcaacagagacaggtccaacaatatc
acggactcgctggctaaccgcacactcattgtcaccactattctggaagagccctacgtg
atgtacaggaaatccgataagcccttgtatggaaacgacaggtttgaaggatattgcctg
gatctgctgaaagaactgtccaatatcctgggttttctttacgatgttaaactggttcct
gatggcaaatatggagcacagaatgacaaaggggaatggaatgggatggtaaaagaactc
atcgaccacagagctgacctggcagtggcccctctcaccatcacatacgtacgggagaaa
gtcattgacttctccaagcccttcatgaccctgggcattagcatcctttaccggaagccc
aatggaaccaacccgggtgtcttctccttcctcaaccccctatctccggacatttggatg
tacgtgctgctcgcctgcctaggagtcagttgtgtactgtttgtgattgcgaggttcaca
ccctacgagtggtataacccccacccatgcaaccccgactcagacgtggtggaaaacaat
ttcactttgctaaatagtttctggtttggagttggagctctcatgcagcaaggatcagag
ctgatgcccaaggctctatcgaccagaatagttggaggaatatggtggtttttcacccta
atcatcatttcatcctacacggccaacctggctgccttcttgacggtagaaagaatggaa
tcccccatcgattccgcagacgatctggccaaacaaaccaagatagaatatggggcagtc
agagatggctcgacgatgaccttcttcaagaaatcaaagatctccacctatgagaaaatg
tgggctttcatgagcagtagacagcagagcgcactggttaaaaacagtgacgaggggatc
caaagggtgctcaccaccgactacgcactgctgatggagtccaccagcattgagtatgtg
acgcagaggaactgcaacctcactcagatcgggggcctcatagactccaaaggctatgga
gtggggacgcctatcggctccccttaccgggataaaattacgattgccattcttcaactg
caagaagaagggaagcttcatatgatgaaagagaagtggtggagggggaatggctgccct
gaagaagacagtaaggaagccagtgctctgggagtggaaaatatcggcggcatcttcatt
gttctggctgcaggactcgtgctttctgtgtttgtagccattggagaatttttatacaaa
tcacggaagaacaatgacgttgagcagaaaggaaagtcatcaagacttagattttatttt
aggaacaaagtaaggtttcatgggagcaaaaaagagagccttggtgtagagaagtgtctc
tctttcaatgccatcatggaagagctgggaatatccctcaagaatcagaaaaaattaaag
aaaaagtcaagaactaagggcaaatcttctttcacaagtatccttacttgtcaccagaga
cgaactcagagaaaagagacagtggcgtga

DBGET integrated database retrieval system