KEGG   Rattus norvegicus (rat): 295629Help
Entry
295629            CDS       T01003                                 

Gene name
Cd302, RGD1307606
Definition
(RefSeq) CD302 molecule
  KO
K06722  CD302 antigen
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    295629 (Cd302)
CD molecules [BR:rno04090]
 Proteins
  295629 (Cd302)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C UL45 IN_DBD_C
Motif
Other DBs
NCBI-GeneID: 295629
NCBI-ProteinID: NP_001013938
RGD: 1307606
Ensembl: ENSRNOG00000006623
UniProt: Q5FVR3
Position
3q21
AA seq 228 aa AA seqDB search
MPHAALSSLVLLSLATAIFADCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGAD
LVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGED
LVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNHILISTLVIASTVTLA
VLGAVIWFLYRRSARSGFTSFSPAPQSPYSDGCALVVSEEDEYSVQLD
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccccacgcagcgctatcctcgctcgtgctgctgagcctagccactgccatcttcgct
gactgtccttcgtccatctgggttcagttccaaggcagctgttacacttttcttcaagta
accatcaatgtggaaaacatagaggatgtcagaaagcagtgtactgatcacggggcagac
ctggtaagtatacacaatgaagaagaaaacgcatttatactggacactttacaaaagcga
tggaaaggcccggatgatcttctgctaggcatgttttatgacactgatgatgcaagtttc
aagtggtttgatcagtcaaatatgacattcgacaagtgggcagatgaggatggtgaggac
ctagttgacacctgtggttttctgtatgccaagacaggtgaatggagaaaaggaaattgt
gaaatgtcttctgtgacaggaacactttgcaaaacagcaatcccatatgacaagaagtat
ttatcagataaccacattttaatatcgactctggtgatcgctagcacagtgactctggca
gttttgggagcggtcatttggttcctctatagaaggagcgcacgctctggcttcacctct
ttctctcctgcaccacaatcaccttacagtgatggctgtgctctggtagtttcggaagaa
gatgaatactctgttcagctggactga

DBGET integrated database retrieval system