KEGG   Rattus norvegicus (rat): 295669
Entry
295669            CDS       T01003                                 

Gene name
Cybrd1, Dcytb
Definition
(RefSeq) cytochrome b reductase 1
  KO
K08370  cytochrome b reductase 1 [EC:7.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    295669 (Cybrd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    295669 (Cybrd1)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.1  Linked to oxidoreductase reactions
    7.2.1.3  ascorbate ferrireductase (transmembrane)
     295669 (Cybrd1)
Transporters [BR:rno02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   295669 (Cybrd1)
SSDB
Motif
Pfam: Cytochrom_B561
Other DBs
NCBI-GeneID: 295669
NCBI-ProteinID: NP_001011954
RGD: 1305740
Ensembl: ENSRNOG00000009620
UniProt: Q5RKJ2
Position
3q22
AA seq 286 aa
MAMEGYRGFLGLLVSALLVGFLSVIFVLIWVLHFREGLGWDGGALEFNWHPVLAVTGFVF
IQGIAIIVYRLPWTWKCSKFLMKSIHAGLNAVAAILAIISVVAVFDYHNVRKIPHMYSLH
SWVGLTVLILYIQQLVVGFFIFLLPWAPPSLRAIVMPIHVYSGLLLFGTVIATVLMGVTE
KLFFVLKNPSYHSFPPEGVFTNTLGLLILVFGALIFWIVTRPQWKRPREPGSIPLQLNGG
NADGMEGAIAISSAHNMDAADAELSSEGAARKRTLGLVDTGQRSTM
NT seq 861 nt   +upstreamnt  +downstreamnt
atggccatggaaggctaccggggcttcctgggactgctggtgtccgcgctgctcgtgggc
ttcctgtcggtgatcttcgtgctcatctgggtcctgcacttccgagaggggcttggctgg
gacggcggcgcgctcgagtttaactggcacccggtgctcgccgtgaccggcttcgtcttc
atccagggcatcgccatcatcgtgtacagattgccatggacctggaagtgcagcaagttc
ttgatgaaatccatccacgccgggttaaacgctgtggctgccatcctggccatcatctca
gtcgtggccgtgtttgattatcacaatgtccgaaaaatcccccacatgtacagtctgcac
agctgggttggactgacagttctcatactctacatccaacagcttgttgtaggctttttc
atctttctgcttccatgggctccgccctctctccgggcaatcgtcatgcccatacatgtg
tattctggactcctcctctttggaacagtgattgccacggtcctcatgggagtgacggaa
aagctgttctttgtcctgaaaaatccttcgtaccattcattcccaccagaaggtgttttt
acaaataccctgggccttctgattctggtatttggagccctcatcttttggattgtcacc
aggccacaatggaaacgccctagggaaccaggctctatccctcttcagctaaatggaggc
aacgcagacggaatggagggcgccatagcaataagctccgcccacaacatggacgctgca
gacgcagagttaagcagcgagggagcagcccggaaaagaaccctcggccttgttgacact
ggccagaggtccaccatgtga

DBGET integrated database retrieval system