KEGG   Rattus norvegicus (rat): 29568
Entry
29568             CDS       T01003                                 

Gene name
Map2k5
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 5 isoform a
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04540  Gap junction
rno04722  Neurotrophin signaling pathway
rno04921  Oxytocin signaling pathway
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29568 (Map2k5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    29568 (Map2k5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    29568 (Map2k5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    29568 (Map2k5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    29568 (Map2k5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29568 (Map2k5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     29568 (Map2k5)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE7 family
   29568 (Map2k5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 ABC1 Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 29568
NCBI-ProteinID: NP_001029159
RGD: 61890
Ensembl: ENSRNOG00000007926
UniProt: Q62862
Position
8
AA seq 448 aa
MLWLALGPFRAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHTSPVVSDSLPSNSLKKSSAELRKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTSGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPLGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNATVVSMWVCRALEERRSQQGPP
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctgtggctggcccttggcccctttcgtgccatggagaaccaggtgctggtgattcgg
atcaagattccaaatagtggcgcggtggactggaccgtgcactccgggccgcagttactc
ttcagggacgtgctggatgtgataggccaggttctgcctgaagcaacgacgacagccttt
gaatatgaagatgaagatggtgataggattacagtaagaagtgacgaagagatgaaggca
atgctgtcctactattattccacagtaatggaacagcaagtaaatggccagctaatagag
ccgctgcagatctttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacacgggctggaccatctcagcacaccagccctgtggtctcagattcactt
ccaagcaatagcttgaagaagtcctcggctgaactgagaaagatactggccaacggccag
atgaatgaacaagacatacggtatcgagacacccttggtcatggcaacggaggcacagtc
tacaaagcatatcatgtcccaagtgggaaaatcttagctgtaaaggttattctgttagac
atcacactggagcttcagaagcagatcatgtctgagttggaaattctttataagtgtgac
tcatcgtatatcataggattttacggggcattttttgtagaaaacaggatttcgatttgt
acagaattcatggatggggggtctttggatgtatataggaaaattccagagcacgtcctc
ggaagaattgcagtagcagttgttaaaggccttacctatctgtggagtttaaagatttta
cacagagatgtgaagccttccaacatgcttgtaaacacaagcggacaggtcaagctgtgt
gacttcggcgtgagcacccagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcacccgaaaggatttcaggagagcagtatgggatccattccgacgtgtgg
agcttagggatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
ccggtccttccgcttggagagttctcggagccgtttgtacatttcatcactcagtgcatg
aggaagcagcccaaggaaagaccagcgcccgaggagctgatgggtcacccattcatcgtg
cagttcaatgacggaaacgccactgtggtgtccatgtgggtttgccgagctctggaggag
agacggagccagcaggggcccccatga

DBGET integrated database retrieval system