KEGG   Rattus norvegicus (rat): 295690Help
Entry
295690            CDS       T01003                                 

Gene name
Dnajc10
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C10
  KO
K09530  DnaJ homolog subfamily C member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    295690 (Dnajc10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    295690 (Dnajc10)
   04131 Membrane trafficking [BR:rno04131]
    295690 (Dnajc10)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   295690 (Dnajc10)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    295690 (Dnajc10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin DnaJ Thioredoxin_2 Thioredoxin_8 OST3_OST6 Thioredoxin_6 Redoxin TraF RMMBL
Motif
Other DBs
NCBI-GeneID: 295690
NCBI-ProteinID: NP_001099956
RGD: 1307813
Ensembl: ENSRNOG00000006803
UniProt: Q498R3
Position
3q24
AA seq 793 aa AA seqDB search
MGVWLNRDEFIRDVKRISLCLLVLYVVIVVGTDQNFYSLLGVSKTASSREIRQAFKKLAL
KLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWSYYRY
DFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLR
IGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVSFAMQHVRTTVTEL
STGNFVNAIETAFAAGIGWLITFCFKGEDCLTPQTRLRLSGMLDGLVNVGWVDCDTQDSL
CKSLDATASTTAYFPPGATLNNKEKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANKLED
RLAHHRWLVFFHFGKNENANDPELKKLKTLLKNEHIQVGRFDCSSAPGICSDLYVFQSCL
AVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPWC
PPCRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSVHEYEGH
HSAEQILEFIEDLRNPSVVSLTPTTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKR
MARTLTGLINVGSVDCQQYHSFCTQENVQRYPEIRFYPQKSSRAYQYHSYNGWNRDAYSL
RSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVIDFYAPWCGPCQNFAPEFELLARMIKGK
VKAGKVDCQAYPQTCQKAGIRAYPSVKLYLYERAKKSIWEEQINSRDAKTIAALIYGKLE
TFQSQVKRNKDEL
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgggagtctggttaaacagagatgaatttatcagagacgtgaagcggataagtctctgt
cttctagtactgtatgtggttatcgtggtgggcacggatcagaatttttacagtttactt
ggagtgtctaaaactgcaagcagcagagaaataagacaagcctttaagaaattagcactg
aagttacatcctgataaaaacccgaataacccaaatgcacatggtgattttttaaaaata
aatagagcatatgaagtactcaaagatgaagatctgcggaaaaagtatgacaaatacgga
gaaaagggcctggaagataatcagggaggccagtacgagagctggagctactaccgctac
gacttcggtatttacgatgatgatcctgagatcataacattagaaagaagagaatttgat
gctgctgtcaactcgggagaactgtggtttgtaaacttttactccccgggatgttcgcat
tgccatgatttagcccccacttggagagaatttgctaaagaagtggatggattgcttcga
atcggagctgtcaactgtggtgatgaccggatgctttgccgaatgaaaggagtcaacagt
taccccagcctcttcatctttaggtctggaatggctgcagtgaagtacaacggggatagg
tcaaaggagagcttagtgagcttcgccatgcagcacgtcaggaccacagtgacagagctg
tcaacaggaaattttgttaatgccatagaaactgcctttgctgctggtattggctggctg
atcacattctgttttaaaggagaagattgtttgacaccacagacacgactccggcttagt
ggcatgttggatggccttgttaacgtgggatgggtggactgtgacacacaggacagcctc
tgcaagagcctggacgccacagccagcactactgcctatttccctcctggagccactttg
aataacaaagaaaaatccagtgttttgtttcttaattctctggatgctaaggaaatatac
atggaaatcatacataatcttccagactttgaacttctttcagcaaataaactagaggat
cgtttggcacatcatcgctggcttgtattttttcattttggaaaaaatgaaaatgcaaat
gatcctgaattgaaaaaactgaaaactctacttaaaaatgaacatattcaagttggaagg
tttgactgctcttctgcaccaggcatctgctctgatctttatgttttccagtcttgtcta
gcagtgtttaaaggacaaggaaccaaagaatatgaaattcatcacggaaagaagattcta
tacgatatacttgcttttgccaaagaaagtgttaattcgcacgttaccacacttggacct
cagaacttccctgcaagtgacaaagaaccgtggcttgttgacttctttgccccttggtgt
ccgccatgccgtgcgcttttgccagagttacggaaagcatcaacactgctctatggtcag
ctcaaagttggtaccctagactgcacaattcatgaaggactctgcaacatgtataacatc
caagcttatccaacaacagtggtgttcaaccagtccagtgttcatgagtatgaaggacat
cattctgcggaacagatcctggagttcatagaggatctcagaaacccttccgtggtctct
cttacacccaccactttcaatgaactagttaaacagagaaaacatgacgaagtctggatg
gttgatttctattctccatggtgtcatccctgtcaggtcttaatgccagagtggaaacgc
atggcccggacgttaactggattgatcaatgtaggcagtgtggactgccaacagtatcat
tctttttgtactcaagaaaatgtccagagataccctgagataagattttatccccaaaag
tcaagtagagcttatcagtatcatagttacaatggctggaatagggatgcttattccctg
agaagctggggtctcgggtttttaccccaagcatccatagatttaacacctcagacattc
aacgaaaaagttctacaagggaaaactcactgggtgattgatttctatgctccttggtgt
ggaccttgccagaattttgctcccgagtttgaactcttggctaggatgatcaaagggaaa
gtaaaagctgggaaagtggactgtcaggcttacccccaaacgtgccagaaagctggcatc
agagcctaccccagtgtcaaactgtacctctatgaaagagcaaagaaaagtatttgggaa
gagcaaataaattccagagatgcaaaaactattgctgccttaatttatggaaaattggaa
acgttccaaagccaagtaaagagaaataaggatgagctctga

DBGET integrated database retrieval system