KEGG   Rattus norvegicus (rat): 295691Help
Entry
295691            CDS       T01003                                 

Gene name
Frzb
Definition
(RefSeq) frizzled-related protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR
Motif
Other DBs
NCBI-GeneID: 295691
NCBI-ProteinID: NP_001093997
RGD: 1311315
Ensembl: ENSRNOG00000007765
UniProt: B2GUW1
Position
3q24
AA seq 323 aa AA seqDB search
MVCRGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPESLACEELPVYDRGVCISPEAIVTADGADFPMDSSTGHCRGTSSERCKC
KPVRATQKTYFRNNYNYVIRAKVKEVKMKCHDVTAIVEVKEILKASLVNIPRDTVNLYST
SGCLCPPLSVNEEYVIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLGK
TDASDSTQNQKSGRNANPRPARS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtctgccgcggcccgggacggatgctgctaggatgggccgggctgttggtcctggct
gctctctgcctgctccaggtacccggagcccaggcagcagcctgcgagcctgtccgcatc
cccctgtgcaagtccctaccctggaacatgaccaagatgcccaaccacctgcaccacagt
acccaggctaacgccatcctggccatcgaacaattcgaagggctgctgggcacccactgc
agcccggatcttctcttcttcctctgtgccatgtacgcacccatttgcaccatcgacttc
cagcacgagcccatcaagccctgcaagtccgtgtgtgagcgcgcccgacagggctgcgag
cccatcctcatcaagtaccgccactcgtggccggaaagcttggcctgcgaagagctgccg
gtgtacgaccgcggcgtgtgcatctctccggaggccatcgtcaccgcggacggagccgat
tttcctatggattcgagcactggacactgcagagggacaagcagtgaacgttgcaaatgt
aagcctgtcagagctacacagaagacctatttccggaacaattacaactatgtcatccgg
gctaaagttaaagaggtaaagatgaaatgtcatgacgtgaccgccattgtggaggtgaag
gaaattctaaaggcatcactggtaaacattccaagggataccgtcaacctgtacagcacc
tctggctgcctctgccctcccctcagtgttaatgaggagtatgtcatcatggggtatgaa
gatgaagagcgctccaggttactcttggtagaaggctctatcgctgagaagtggaaggat
cggcttggtaagaaagtcaagcgctgggatatgaaactccgtcatcttggactgggtaaa
actgatgccagcgattccactcagaatcagaagtctggcaggaacgctaatccccggcca
gcgcgcagctga

DBGET integrated database retrieval system