KEGG   Rattus norvegicus (rat): 295703Help
Entry
295703            CDS       T01003                                 

Gene name
Serping1
Definition
(RefSeq) serpin family G member 1
  KO
K04001  C1 inhibitor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05133  Pertussis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    295703 (Serping1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    295703 (Serping1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    295703 (Serping1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    295703 (Serping1)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   295703 (Serping1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   295703 (Serping1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 295703
NCBI-ProteinID: NP_954524
RGD: 735225
Ensembl: ENSRNOG00000007457
UniProt: Q6P734
Position
3q24
AA seq 504 aa AA seqDB search
MASKLTPLTLLLLLLAGDRAFSDSEVTSHSSQDPLVVQEGSRDSVPERDGSRSPIEHTGQ
SSTWPTTSGSTKISNDTMDQVANESFIQHVQPAAQLPEDSPSQSPVNSSSPPSTASAPPT
QAPTEPLCPEPLAWCSDSDRDSSEATLSEALTDFSVKLYHAFSATKKAETNMAFSPFSIA
SLLTQVLLGAGDSTKSNLEDILSYPKDFACVHQTLKAFSSKGVTSVSQIFHSPDLAIRDT
YVNASLSLYGSSPRVLGPDGDANLKLINTWVAENTNHKINELLDSLPSDTRLVLLNAVYL
SAKWKKTFEQKKMMASFLYKNSMIKVPMLSSKKYPLALFNDQTLKAKVGQLQLSHNLSFV
IMVPQSPTHQLEDMEKALNPTVFKAILKKLELSKFQPTYVMMPRIKVKSSQDMLSIMEKL
EFFDFTYDLNLCGLTEDPDLQVSSMKHETVLELTETGVEAAAASTISVARNLLIFEVQQP
FLFLLWDQRHKFPVFMGRVYDPRA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaagctgaccccactgaccctcctcctgctgctgctagctggggatagagcc
ttctcagattctgaagtgaccagccacagctcccaggatccactagtagttcaagaggga
agcagggacagcgttcctgaaagagatggctcccggagtcccattgagcacacaggacag
tcttctacctggccaacaaccagtggatccaccaaaatatcaaatgacaccatggatcaa
gtagccaacgagtccttcatccagcatgtccaaccagctgctcagctacctgaggattct
cccagccagtctcccgtgaattcttccagcccgccctccacagcctcagcccctcccacc
caggctccgactgagcccctctgcccagagccacttgcttggtgctctgattcagacaga
gactcctcagaggctacgttgtcggaggctttgacagatttctctgtgaaactctaccac
gccttctcggctacgaagaaggctgagaccaacatggccttttccccattcagcattgct
agcctcctcacgcaggtccttcttggggctggagacagcaccaagagcaacttggaggac
atcctttcctaccccaaggattttgcctgtgtccaccagacactaaaggctttttcatcc
aaaggtgtcacttctgtgtctcagattttccacagcccagatctagccatacgggacacc
tatgtgaacgcctctctgagcctgtatggaagcagccccagagtcctgggtccagacggt
gatgctaacttaaaactcatcaacacctgggtggcggagaacaccaaccacaagatcaat
gagctgctggacagcctgccctctgacacccgcctcgtccttctcaatgccgtctacttg
agtgccaagtggaagaaaacctttgagcaaaagaagatgatggcatctttcctctacaaa
aactctatgattaaagtgcccatgttgagtagcaaaaagtaccctctggcccttttcaat
gaccagactttgaaggccaaggtgggacagctgcagctctctcacaacctgagctttgtg
atcatggtaccccagagcccgacacaccaacttgaagacatggaaaaggcactcaacccc
actgtctttaaggccatcctgaagaagctagagctgtccaagtttcagcccacttacgtg
atgatgcctcgcattaaagtaaagagcagccaagacatgctgtcaatcatggagaaactg
gaattctttgacttcacttacgatctcaacctgtgtgggctgactgaggacccagatctt
caggtgtcttccatgaaacacgagacggtgttggaactgacagagacaggtgtggaagca
gccgcagcctccaccatctccgtggcccgaaacttactcatctttgaggtgcagcagcct
ttcctcttcctgctctgggaccagcgacacaagttcccagtcttcatgggccgtgtatat
gaccccagggcctga

DBGET integrated database retrieval system