KEGG   Rattus norvegicus (rat): 29573
Entry
29573             CDS       T01003                                 

Gene name
Slc37a4, G6pt1
Definition
(RefSeq) solute carrier family 37 member 4
  KO
K08171  MFS transporter, OPA family, solute carrier family 37 (glycerol-6-phosphate transporter), member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    29573 (Slc37a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29573 (Slc37a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC37: Sugar-phosphate/phosphate exchanger
   29573 (Slc37a4)
 Major facilitator superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    29573 (Slc37a4)
SSDB
Motif
Pfam: MFS_1 Sugar_tr PTR2
Other DBs
NCBI-GeneID: 29573
NCBI-ProteinID: NP_113777
RGD: 62066
Ensembl: ENSRNOG00000011361
UniProt: Q6IRK4
Position
8q22
AA seq 429 aa
MAAQGYGYYRTVIFTAMFGGYSLYYFNRKTFSFVMPSLVDEIALDKDDLGLITSSQSAAY
AISKFVSGVLSDQMSARWLFSSGLLLVGLVNVVFSWSSTVTAFAALWFLNGLAQGLGWPP
CGKILRKWFEPSQFGTWWAVLSTSMNLAGSLGPILATILAQSYSWRSTLALSGSLCVVVS
FFCLLLIHNEPADVGLRNLDPAPSKGKKGSSKEESTLQDLLLSPYLWVLSTGYLVVFGVK
TCCTDWGQFFLIQERGQSALVGSSYISALEVGGLVGSIAAGYLSDRAMAKAGLSVYGNPR
HSLLLLMMAGMAASMFLFRVTVTSDSPKIWILVLGAVFGFSSYGPIALFGVIANESAPPN
LCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVAEVICIASTVVFFLLRNIRTK
MGRVSKKAE
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggcggcccaaggctatggctattaccgcactgtcatattcacagccatgttcggaggc
tacagcctttactacttcaaccgcaaaaccttctcttttgtcatgccctccttggtggat
gagatcgctctggacaaggacgatttggggctcatcacgagcagccagtcggcagcctac
gccatcagcaagtttgtgagcggggtgctgtctgatcagatgagtgcccgttggctcttc
tcctctgggctgctcctggttggtctggtcaacgtagtcttctcgtggagctctacagtg
acggcttttgctgctctctggtttcttaatggtctggcacaggggctaggctggcccccc
tgtgggaagatcctgaggaagtggtttgagccatcccagtttggcacttggtgggctgtg
ttgtcaaccagcatgaacctggctggaagcctgggacctatcttggcgacaatccttgct
cagagctacagctggcgcagcaccctggccctgtctgggtcactgtgtgtggttgtctcc
ttcttctgtctgctgctcatccacaacgaacctgctgatgttggactccgaaatctggac
cctgccccctccaagggcaaaaagggctcgtcaaaggaggagagcaccctacaggacctg
ctgctgtccccctatctctgggtgctctccactggctacctcgtggtctttggggtaaag
acttgctgtacagactggggccagttcttccttatccaggagagagggcagtcggccctc
gtgggtagttcctacatcagtgccctagaggttggaggccttgtaggcagcattgcagct
ggctatctgtcagacagggctatggcaaaggcagggctgtctgtgtatgggaaccctcgc
cacagcctgttgctgctcatgatggctggcatggcagcatccatgttcctcttccgggta
acggtgaccagcgactcgcccaagatctggatcctggtgttgggagccgtgtttggtttc
tcttcttatggtcccattgccttgtttggagtcatagctaatgagagtgcacctcccaac
ttgtgtggtacctctcatgctattgtggggctcatggccaatgtgggtggatttctggct
gggttacccttcagtaccatcgccaagcactatagctggagcacagccttctgggtggca
gaagtgatctgtatagccagcacagttgtcttcttcttgcttcgaaatatccgcaccaag
atgggccgagtatccaagaaggcagagtga

DBGET integrated database retrieval system