KEGG   Rattus norvegicus (rat): 29576Help
Entry
29576             CDS       T01003                                 

Gene name
Wisp2, CCN5
Definition
(RefSeq) WNT1 inducible signaling pathway protein 2
  KO
K23089  WNT1-inducible-signaling pathway protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    29576 (Wisp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGFBP VWC
Motif
Other DBs
NCBI-GeneID: 29576
NCBI-ProteinID: NP_113778
RGD: 621867
Ensembl: ENSRNOG00000010666
UniProt: Q9JHC6
Position
3q42
AA seq 250 aa AA seqDB search
MRGSPLIRLLATSFLCLLSMVCAQLCRTPCTCPWTPPQCPQGVPLVLDGCGCCKVCARRL
TESCEHLHVCEPSQGLVCQPGAGPGGHGAVCLLDEDDGDCEVNGRRYLDGETFKPNCRVL
CRCDDGGFTCLPLCSEDVTLPSWDCPRPKRIQVPGKCCPEWVCDQGVTPAIQRSAAQGHQ
LSALVTPASADAPWPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLPRPCLAA
RSHSSWNSAF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcagcccactgatccgtcttctggccacttccttcctctgccttctctcaatg
gtgtgtgcccagctgtgccggacaccctgcacctgtccttggacaccaccccagtgccca
cagggggtacccctggtgctggatggctgtggctgctgtaaagtgtgtgcacggaggctg
acggagtcctgcgaacacctgcatgtctgcgaacccagccagggcctggtttgtcagcct
ggggcaggccctggcggccatggggctgtgtgtctcttggatgaggatgacggtgactgt
gaggtgaatggccgcaggtacctggatggagagacctttaaacccaattgcagggtcctg
tgccgctgtgatgacggtggcttcacctgcctcccgctgtgcagtgaggatgtgacgctg
cccagctgggactgcccacgccccaagagaatacaggtgccaggaaagtgctgccccgag
tgggtatgtgaccagggagtgacaccggcgatccagcgctccgcggcgcaaggacaccaa
ctttctgcccttgtcactcctgcctctgctgatgctccttggccaaattggagcacagcc
tggggcccctgctcaaccacctgtgggctgggcatagccacccgagtgtccaaccagaac
cgattctgccaactggagatccaacgccgcctgtgtctgcccagaccctgcctggcagcc
aggagccacagctcatggaacagtgctttctaa

DBGET integrated database retrieval system